KEGG   Rattus norvegicus (rat): 114487
Entry
114487            CDS       T01003                                 

Gene name
Wnt2
Definition
(RefSeq) protein Wnt-2
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    114487 (Wnt2)
   04390 Hippo signaling pathway
    114487 (Wnt2)
   04150 mTOR signaling pathway
    114487 (Wnt2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    114487 (Wnt2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    114487 (Wnt2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114487 (Wnt2)
   05205 Proteoglycans in cancer
    114487 (Wnt2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    114487 (Wnt2)
   05226 Gastric cancer
    114487 (Wnt2)
   05217 Basal cell carcinoma
    114487 (Wnt2)
   05224 Breast cancer
    114487 (Wnt2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    114487 (Wnt2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    114487 (Wnt2)
   05022 Pathways of neurodegeneration - multiple diseases
    114487 (Wnt2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    114487 (Wnt2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    114487 (Wnt2)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Morphogens
   114487 (Wnt2)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 114487
NCBI-ProteinID: XP_575397
RGD: 621346
Ensembl: ENSRNOG00000051905
UniProt: Q2IBD1
Position
4
AA seq 360 aa
MNVPLGGIWLWLPLLLTWLTPEVSSSWWYMRATGGSSRVMCDNVPGLVSRQRQLCHRHPD
VMRAIGLGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVV
FAITRACSQGELKSCSCDPKKKGSGKDSKGTFDWGGCSDNIDYGIKFARAFVDAKERKGK
DARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNG
AIQVVMNQDGTGFTVANKRFKKPTKNDLVYFENSPDYCIRDREAGSLGTAGRVCNLTSRG
MDSCEVMCCGRGYDTSHVTRMTKCECKFHWCCAVRCQDCLEALDVHTCKAPKSADWTTPT
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaacgtccctctcggtggaatctggctctggctccctctgctcttgacctggctcacc
cctgaggtcagctcttcatggtggtacatgagagcgacaggtggctcctccagggtgatg
tgtgacaatgtgccaggtctggtgagccgccagcgtcagctgtgccaccgacacccagac
gtgatgcgtgccattggcctgggcgtggctgagtggacagcagagtgccagcatcagttc
cgccagcatcgctggaactgcaacaccctggacagagaccacagcctctttggccgggtc
ctcctccgaagtagccgggaatcggcctttgtttacgccatctcctcagctggcgttgta
tttgccatcaccagggcctgtagccaaggagaattaaagtcctgttcctgcgatccaaag
aagaaagggagtggcaaggacagcaaaggtaccttcgactggggcggctgtagtgacaac
attgactacgggatcaaattcgcccgtgcatttgtagatgccaaggaaaggaaaggaaag
gatgccagagccctgatgaatcttcacaacaacagagctggaaggaaggctgtaaagcgc
ttcctgaaacaagaatgcaagtgtcatggcgtgagcggttcctgtactctgaggacatgc
tggctggccatggctgacttcaggaaaacaggcgactatctctggaggaagtacaacggg
gccatccaggtggtcatgaaccaggacggcactggcttcactgtagccaataagaggttt
aagaagccaacgaaaaatgaccttgtgtattttgagaattctccagactactgtatcagg
gaccgagaggcaggctccctgggtacagcaggccgtgtgtgcaacttgacttcccgaggc
atggacagctgcgaagttatgtgttgtgggagaggctatgacacatcccatgtcacccgg
atgaccaagtgtgagtgtaaattccactggtgctgtgccgtgcgctgtcaggactgcctg
gaagccctggacgtgcacacatgcaaggcccccaagagtgccgactggacaactcctaca
tga

KEGG   Rattus norvegicus (rat): 114850
Entry
114850            CDS       T01003                                 

Gene name
Wnt7a
Definition
(RefSeq) protein Wnt-7a precursor
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    114850 (Wnt7a)
   04390 Hippo signaling pathway
    114850 (Wnt7a)
   04150 mTOR signaling pathway
    114850 (Wnt7a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    114850 (Wnt7a)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    114850 (Wnt7a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114850 (Wnt7a)
   05205 Proteoglycans in cancer
    114850 (Wnt7a)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    114850 (Wnt7a)
   05226 Gastric cancer
    114850 (Wnt7a)
   05217 Basal cell carcinoma
    114850 (Wnt7a)
   05224 Breast cancer
    114850 (Wnt7a)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    114850 (Wnt7a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    114850 (Wnt7a)
   05022 Pathways of neurodegeneration - multiple diseases
    114850 (Wnt7a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    114850 (Wnt7a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    114850 (Wnt7a)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Morphogens
   114850 (Wnt7a)
SSDB
Motif
Pfam: wnt COG6
Other DBs
NCBI-GeneID: 114850
NCBI-ProteinID: NP_001093943
RGD: 69079
Ensembl: ENSRNOG00000048782
UniProt: M0R9D3
Position
4
AA seq 349 aa
MTRKARRCLGHLFLSLGIVYLRIGDFSSVVALGASIICNKIPGLAPRQRAICQSRPDAII
VIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAIT
AACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLM
NLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEP
VRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQ
ASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEMYTCK
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgacccggaaagcgcggcgctgcctgggccacctctttctcagcctgggcatagtctat
ctccggatcggtgacttctcttcggttgtggctctgggtgcgagcatcatctgtaacaag
atcccaggcctggctcccagacagcgggcaatctgccagagtcggccggacgccatcatc
gtcataggagaaggctcccaaatgggcctggacgagtgtcagtttcagttccgcaatggc
cgttggaactgttcagcgctgggagagcgcactgtcttcgggaaggagctcaaagtgggg
agtcgggaggccgccttcacctatgcaattattgctgcgggtgtggcccatgccatcacc
gctgcctgcacccaaggcaacctgagtgactgtggctgcgacaaggagaagcaaggccag
taccaccgggacgagggctggaagtggggtggctgctctgccgacatccgctacggcatc
ggcttcgccaaggtcttcgtggatgcccgagagatcaagcagaatgcccgaaccctcatg
aacttacacaataacgaggcaggccggaagatcctggaggagaacatgaaactggagtgt
aagtgccatggcgtgtcaggatcctgtaccactaagacgtgctggaccacactgccacaa
ttccgagagctaggctacgtgctcaaggacaaatacaacgaggccgtccatgtggaacct
gtccgtgccagtcggaacaagcggcccacctttctgaagatcaagaagcccctgtcctac
cgtaagcccatggacactgatctggtgtacatcgagaagtcacccaattactgtgaagag
gacccagtgacaggcagcgtgggcacacagggccgtgcctgcaataagacagcccctcag
gctagtggctgtgacctcatgtgctgcggccgtggctacaacacacaccagtatgcccgg
gtgtggcagtgcaactgcaaattccactggtgctgctacgtcaagtgtaacacatgcagc
gagcgcacagagatgtatacgtgcaagtga

KEGG   Rattus norvegicus (rat): 116466
Entry
116466            CDS       T01003                                 

Gene name
Wnt2b
Definition
(RefSeq) protein Wnt-2b
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    116466 (Wnt2b)
   04390 Hippo signaling pathway
    116466 (Wnt2b)
   04150 mTOR signaling pathway
    116466 (Wnt2b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    116466 (Wnt2b)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    116466 (Wnt2b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    116466 (Wnt2b)
   05205 Proteoglycans in cancer
    116466 (Wnt2b)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    116466 (Wnt2b)
   05226 Gastric cancer
    116466 (Wnt2b)
   05217 Basal cell carcinoma
    116466 (Wnt2b)
   05224 Breast cancer
    116466 (Wnt2b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    116466 (Wnt2b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    116466 (Wnt2b)
   05022 Pathways of neurodegeneration - multiple diseases
    116466 (Wnt2b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    116466 (Wnt2b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    116466 (Wnt2b)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Morphogens
   116466 (Wnt2b)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 116466
NCBI-ProteinID: NP_001178777
RGD: 69346
Ensembl: ENSRNOG00000014385
UniProt: G3V7U3
Position
2
AA seq 391 aa
MLKPRGEDEAAQLAPRRARVPVAALRPAPPDVSPASARLGLACLLLLLLLTLPARVDTSW
WYIGALGARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTT
LDRDHTVFGRAMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHDQR
GDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECKCH
GVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVTATQDGANFTAARQGYRHATRTDLV
YFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECKFH
WCCAVRCKECRNTVDVHTCKAPKKAEWLDQT
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgctgaagccgcggggtgaggacgaagccgcgcagctcgcccctcggcgtgcccgcgtc
ccggtcgccgcgttaagacccgcgccccccgacgtgtccccagcttctgcccgtctgggt
cttgcctgtctgctgctgctgctgcttctgactctgccggcccgtgtagacacgtcctgg
tggtacataggggcactgggagcccgagtgatctgtgacaacatcccgggtctggtgagc
cggcagcggcagctgtgtcagcgctacccagacatcatgcgctcagtaggagaaggtgcc
cgggaatggatccgagagtgtcaacaccagttccgtcatcaccgctggaattgcaccaca
ctggaccgggaccacactgtctttggccgtgctatgctcagaagcagtcgggaggcagcg
tttgtctatgctatctcatcagcaggagtggtccatgctatcactcgggcctgcagccag
ggtgagctgagtgtgtgcagctgtgacccatatacccgtggtcggcaccatgatcaacga
ggggactttgactggggtggctgtagtgacaacatccactatggtgtccgctttgccaag
gcttttgtggatgccaaagagaagaggcttaaggatgcccgggccctcatgaacttacat
aacaaccgctgcggtcgcacggctgtacggcgatttctgaagctggagtgcaagtgtcat
ggtgtgagtggctcctgtaccctgcgcacctgctggagggcactctcagacttccgccgt
accggtgactacctgaggaggcgatatgatggggctgtgcaggtgacagccacacaggat
ggggccaacttcacagcagcccgccaaggctatcgccatgccacccggactgatcttgtc
tactttgacaactcccctgactactgtgtcttggacaaggctgcaggttccctaggtacc
gcaggccgcgtctgcagcaagacttctaaaggaacagatgggtgtgaaatcatgtgttgc
ggccgaggatatgacacaactcgggtcacccgggtcacccagtgtgagtgcaaattccac
tggtgctgtgctgtgcggtgcaaggagtgcagaaacactgtggatgtccacacgtgcaag
gcccctaagaaggcagagtggctggaccagacctga

KEGG   Rattus norvegicus (rat): 140584
Entry
140584            CDS       T01003                                 

Gene name
Wnt11
Definition
(RefSeq) protein Wnt-11
  KO
K01384  wingless-type MMTV integration site family, member 11
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    140584 (Wnt11)
   04390 Hippo signaling pathway
    140584 (Wnt11)
   04150 mTOR signaling pathway
    140584 (Wnt11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    140584 (Wnt11)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    140584 (Wnt11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    140584 (Wnt11)
   05205 Proteoglycans in cancer
    140584 (Wnt11)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    140584 (Wnt11)
   05226 Gastric cancer
    140584 (Wnt11)
   05217 Basal cell carcinoma
    140584 (Wnt11)
   05224 Breast cancer
    140584 (Wnt11)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    140584 (Wnt11)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    140584 (Wnt11)
   05022 Pathways of neurodegeneration - multiple diseases
    140584 (Wnt11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    140584 (Wnt11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    140584 (Wnt11)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Morphogens
   140584 (Wnt11)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 140584
NCBI-ProteinID: NP_536326
RGD: 621463
Ensembl: ENSRNOG00000015982
UniProt: G3V819
Position
1
AA seq 354 aa
MRARPQVCEALLFALALHTGVCYGIKWLALSKTPAALALNQTQHCKQLEGLVSAQVQLCR
SNLELMRTIVHAAREAMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAA
TISHTIARACTSGDLPGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKK
TGSQANKLMRLHNSEVGRQALRASLETKCKCHGVSGSCSIRTCWKGLQELRDVAADLKTR
YLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCN
KTSNGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVCK
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgagggcgcggccgcaggtctgcgaggctcttctcttcgccctggcgctccacaccggt
gtgtgctatggcatcaagtggctggcattgtccaagactccggcggccctggcactgaat
cagacgcaacactgtaaacagctggagggcctggtgtctgcgcaggtgcagctctgccgg
agcaacctggagctcatgcgcaccattgtgcatgcagcacgggaggccatgaaggcctgc
cgccgggccttcgctgacatgcgctggaactgctcctccatcgagctcgcccccaactac
ctgcttgacctggagagaggtacccgggagtcagccttcgtgtatgccctgtcggccgcc
accatcagtcacaccatcgcccgggcctgcacctctggcgacctgcccggctgctcctgc
ggccctgtcccaggtgagccacccgggcccgggaaccgctggggaggatgtgcggacaac
ctcagctacggtctcctcatgggggccaagttttccgatgctcctatgaaggtgaaaaaa
acaggatcccaagccaataaactgatgcgtctacacaacagtgaagtggggagacaggct
ctacgtgcctccctggaaacgaagtgtaagtgccatggggtatctggctcctgctccatc
cgcacctgttggaaggggctacaagagctccgggatgtggctgctgacctcaagacccgc
tacctgtcagccacgaaagtggtacaccggcctatgggcacccgcaagcacttggtgccc
aaggacctggatatccggcccgtgaaggactcagaactagtgtatctacagagttctcct
gacttctgcatgaagaatgagaaggtgggatcccatgggacccaagacaggcagtgcaac
aagacctccaacggcagtgacagctgcgacctcatgtgctgtgggcgtggctacaacccc
tacacggacagagtggtggagcgatgtcactgcaagtaccactggtgctgctacgtcacc
tgccgcaggtgcgagcgcacagtggagcgctacgtctgcaagtga

KEGG   Rattus norvegicus (rat): 24881
Entry
24881             CDS       T01003                                 

Gene name
Wnt1
Definition
(RefSeq) proto-oncogene Wnt-1 precursor
  KO
K03209  wingless-type MMTV integration site family, member 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05207  Chemical carcinogenesis - receptor activation
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    24881 (Wnt1)
   04390 Hippo signaling pathway
    24881 (Wnt1)
   04150 mTOR signaling pathway
    24881 (Wnt1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    24881 (Wnt1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    24881 (Wnt1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24881 (Wnt1)
   05205 Proteoglycans in cancer
    24881 (Wnt1)
   05207 Chemical carcinogenesis - receptor activation
    24881 (Wnt1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    24881 (Wnt1)
   05226 Gastric cancer
    24881 (Wnt1)
   05217 Basal cell carcinoma
    24881 (Wnt1)
   05224 Breast cancer
    24881 (Wnt1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    24881 (Wnt1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    24881 (Wnt1)
   05022 Pathways of neurodegeneration - multiple diseases
    24881 (Wnt1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    24881 (Wnt1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    24881 (Wnt1)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Morphogens
   24881 (Wnt1)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 24881
NCBI-ProteinID: NP_001099184
RGD: 1597195
Ensembl: ENSRNOG00000061818
UniProt: D4A9J2
Position
7
AA seq 370 aa
MGLWALLPSWVSATLLLALTALPAALGANSSGRWWGIVNIASSTNLLTDSKSLQLVLEPS
LQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRG
CRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLF
GREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLR
AVGDVLRDRFDGASRVLYGNRGNNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCT
YSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNC
THTRVLHECL
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggggctctgggcgctgctgcccagctgggtttctgctacgttgctactggcactgacc
gctctgcccgcagccctgggcgccaacagtagtggccgatggtggggcatcgtgaacata
gcctcctccacgaacctgctgacagattccaagagtctacagctggtgctagagcccagc
ctgcagctactgagccgcaagcagcgacgactgatccgacagaacccggggatcctgcac
agcgtgagcggagggctgcagagcgccgttcgagagtgcaagtggcaattccgaaaccgc
cgctggaactgccccactgctcccgggccccacctcttcggcaagatcgtcaaccgaggc
tgccgagaaacagcgtttatcttcgcaatcacctccgccggggtcacacattctgtggcg
cgctcctgctccgaaggctccatcgaatcctgcacctgcgactacaggcggcgcggtcct
gggggccccgactggcactgggggggttgcagcgacaacatcgatttcggtcgcctcttc
ggccgagagttcgtggactctggggagaaggggcgggacctacgcttcctcatgaacctt
cacaataacgaggcagggcgcacgaccgtgttctctgagatgcgccaagagtgcaaatgc
cacgggatgtccggttcctgcaccgtgcgcacgtgttggatgcggctgcccacactgcgc
gctgtgggcgacgtgctgcgcgaccgcttcgacggcgcctcccgcgtcctttacggcaac
cgaggcaacaaccgcgcttcgcgggcggagctgctgcgcctggagcccgaagaccctgcg
cacaagccgccctcccctcacgacctggtctacttcgagaaatcgcccaacttctgcacg
tacagtggacgcctgggcacagctggcacagctgggcgagcttgcaacagctcatctcca
gcgctggacggctgcgagctgctgtgctgtggccgaggccatcgcacgcgcacgcagcgc
gtcaccgagcgctgcaactgcaccttccactggtgctgccacgtcagctgccgcaactgc
acgcacacgcgcgtactgcacgagtgtctatga

KEGG   Rattus norvegicus (rat): 24882
Entry
24882             CDS       T01003                                 

Gene name
Wnt3
Definition
(RefSeq) proto-oncogene Wnt-3
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    24882 (Wnt3)
   04390 Hippo signaling pathway
    24882 (Wnt3)
   04150 mTOR signaling pathway
    24882 (Wnt3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    24882 (Wnt3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    24882 (Wnt3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24882 (Wnt3)
   05206 MicroRNAs in cancer
    24882 (Wnt3)
   05205 Proteoglycans in cancer
    24882 (Wnt3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    24882 (Wnt3)
   05226 Gastric cancer
    24882 (Wnt3)
   05217 Basal cell carcinoma
    24882 (Wnt3)
   05224 Breast cancer
    24882 (Wnt3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    24882 (Wnt3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    24882 (Wnt3)
   05022 Pathways of neurodegeneration - multiple diseases
    24882 (Wnt3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    24882 (Wnt3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    24882 (Wnt3)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Morphogens
   24882 (Wnt3)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 24882
NCBI-ProteinID: NP_001099185
RGD: 3972
Ensembl: ENSRNOG00000003845
UniProt: D3ZCR1
Position
10
AA seq 355 aa
MEPHLLGLLLGLLLSGTRVLAGYPIWWSLALGQQYTSLASQPLLCGSIPGLVPKQLRFCR
NYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIAS
AGVAFAVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRP
DARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDS
ASEMVVEKHRESRGWVETLRAKYALFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTC
NVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCVFHWCCYVSCQECIRIYDVHTCK
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggagccccacctgctcgggctgctactcggcctcctgctcagtggcaccagggtcctc
gccggctacccaatttggtggtccctggccctgggccagcagtacacgtctctggcctcc
cagcctctgctctgcggctctatcccaggcctggtccccaagcaactgcgtttctgccgc
aattacatcgagatcatgcccagtgtagcggaaggcgtgaagctgggcatccaggagtgc
cagcatcagttccggggacgccgctggaactgtaccaccatagatgacagcctggccatc
tttgggcctgtcctggacaaagccacccgcgaatcggccttcgtgcatgccatcgcctcg
gctggtgtagccttcgcagtcacgcgctcctgtgccgagggaacctctaccatctgcggc
tgcgactcgcatcataaggggccacctggagaaggctggaaatggggcggctgcagcgag
gacgccgacttcggggtgctggtgtcccgggagtttgcggatgcacgggagaacaggcca
gatgcccgctcagctatgaacaagcacaacaacgaggcaggccgaacgaccatcctggat
cacatgcacctgaagtgcaaatgccatgggttgtctggcagctgtgaggtgaagacctgc
tggtgggcccagcctgacttccgagccattggtgacttcctcaaggacaagtacgacagt
gcctcagagatggtggtggagaagcatcgggagtcccgaggctgggtggagacccttcgg
gccaagtatgcactctttaagccacccacggagagggacctggtctactacgagaactcc
cccaacttttgtgagcccaacccagagacgggctcctttggtaccagggaccggacttgc
aatgtcacctcccacggcattgatggctgcgatctgctgtgctgtggcaggggccacaac
accaggacggagaagcggaaggagaaatgtcattgcgtcttccactggtgctgctacgtc
agctgccaggagtgcattcgcatctacgatgtacacacctgcaagtag

KEGG   Rattus norvegicus (rat): 282582
Entry
282582            CDS       T01003                                 

Gene name
Wnt5b
Definition
(RefSeq) protein Wnt-5b precursor
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04360  Axon guidance
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    282582 (Wnt5b)
   04390 Hippo signaling pathway
    282582 (Wnt5b)
   04150 mTOR signaling pathway
    282582 (Wnt5b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    282582 (Wnt5b)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    282582 (Wnt5b)
  09158 Development and regeneration
   04360 Axon guidance
    282582 (Wnt5b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    282582 (Wnt5b)
   05205 Proteoglycans in cancer
    282582 (Wnt5b)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    282582 (Wnt5b)
   05226 Gastric cancer
    282582 (Wnt5b)
   05217 Basal cell carcinoma
    282582 (Wnt5b)
   05224 Breast cancer
    282582 (Wnt5b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    282582 (Wnt5b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    282582 (Wnt5b)
   05022 Pathways of neurodegeneration - multiple diseases
    282582 (Wnt5b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    282582 (Wnt5b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    282582 (Wnt5b)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Morphogens
   282582 (Wnt5b)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 282582
NCBI-ProteinID: NP_001093959
RGD: 628850
Ensembl: ENSRNOG00000008168
UniProt: B1WBR9
Position
4
AA seq 372 aa
MLVPGHWDGLRPAMPSLLLLFVAALLSSWAQLLTDANSWWSLALNPVQRPEMFIIGAQPV
CSQLPGLSPGQRKLCQLYQEHMSYIGEGAKTGIRECQHQFRQRRWNCSTVDNLSVFGRVM
QIGSRETAFTYAVSAAGVVNAISRACREGELSTCGCSRAARPKDLPRDWLWGGCGDNVEY
GYRFAKEFVDAREREKNFAKGSEEQGRALMNLQNNEAGRRAVYKMADVSCKCHGVSGSCS
LKTCWLQLAEFRKVGDRLKEKYDSAAAMRITRQGKLELTNSRFNQPSPEDLVYVDPSPDY
CLRNETTGSLGTQGRLCNKTSEGTDGCELMCCGRGYDRFKSVQVERCHCRFHWCCFVRCK
KCTEIVDQYVCK
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgttggtccctgggcactgggatgggttgaggccggccatgcccagcctgctgctgctg
ttcgtggcagctctgctctccagctgggcacagctgctgactgacgccaactcctggtgg
tcgctggctctgaacccggtgcagagacccgagatgttcatcattggcgctcagcccgtg
tgcagccaacttcccgggctttcgccaggccagcgaaagctgtgtcagttgtatcaggag
cacatgtcctacatcggggagggagccaagacgggcatcagggagtgccagcaccagttt
cgacagaggcggtggaactgcagcaccgtggacaacttgtctgtctttggcagggtcatg
cagataggtagccgagagactgccttcacatatgcggtgagcgctgctggtgtggtgaat
gccatcagccgagcctgcagagagggtgagctgtccacctgtggctgcagccgtgcagcg
aggcccaaggacctgccacgagactggttgtggggcggctgtggggacaacgtggagtat
ggctaccgctttgccaaggagtttgtggatgcccgagagcgtgagaagaactttgccaag
ggatcagaggagcagggccgagccctcatgaacttacagaacaacgaggctggccgccgg
gccgtgtataagatggctgatgtctcctgcaaatgtcacggagtctccgggtcctgcagc
ctcaagacctgctggctccagctggctgagttccgcaaggtgggggaccgtttgaaagag
aagtatgacagcgctgcggccatgcgtatcacccgtcagggcaagctggaactgaccaac
agccgcttcaaccagcccagcccggaggacctggtctacgtagaccccagccctgactac
tgcctgcgaaatgagaccacgggctccctgggcacccaaggtcgcctctgcaacaagacc
tcagagggcacggatggctgcgagctcatgtgctgtggccgcggctatgaccgcttcaag
agcgtccaggtggaacgctgccactgcaggttccactggtgttgctttgtcagatgcaaa
aaatgcaccgagatcgtggaccagtatgtctgtaagtga

KEGG   Rattus norvegicus (rat): 287357
Entry
287357            CDS       T01003                                 

Gene name
Wnt9a
Definition
(RefSeq) protein Wnt-9a precursor
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    287357 (Wnt9a)
   04390 Hippo signaling pathway
    287357 (Wnt9a)
   04150 mTOR signaling pathway
    287357 (Wnt9a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    287357 (Wnt9a)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    287357 (Wnt9a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    287357 (Wnt9a)
   05205 Proteoglycans in cancer
    287357 (Wnt9a)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    287357 (Wnt9a)
   05226 Gastric cancer
    287357 (Wnt9a)
   05217 Basal cell carcinoma
    287357 (Wnt9a)
   05224 Breast cancer
    287357 (Wnt9a)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    287357 (Wnt9a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    287357 (Wnt9a)
   05022 Pathways of neurodegeneration - multiple diseases
    287357 (Wnt9a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    287357 (Wnt9a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    287357 (Wnt9a)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Morphogens
   287357 (Wnt9a)
SSDB
Motif
Pfam: wnt Clr5
Other DBs
NCBI-GeneID: 287357
NCBI-ProteinID: NP_001099253
RGD: 1305018
Ensembl: ENSRNOG00000003066
Position
10
AA seq 365 aa
MLDGSLLARWLAAAFGLTLLLAALRPSAAYFGLTGSEPLTILPLTLETEAAAQAHYKACD
RLKLERKQRRMCRRDPGVAETLVEAVSMSALECQYQFRFERWNCTLEGRYRASLLKRGFK
ETAFLYAISSAGLTHALAKACSAGRMERCTCDEAPDLENREAWQWGGCGDNLKYSSKFVK
EFLGRRSSKDLRARVDFHNNLVGVKVIKAGVETTCKCHGVSGSCTVRTCWRQLAPFHEVG
KHLKHKYETSLKVGSTTNEATGEAGAISPPRGRASGSGGGDPLPRTPELVHLDDSPSFCL
AGRFSPGTAGRRCHREKNCESICCGRGHNTQSRVVTRPCQCQVRWCCYVECRQCTQREEV
YTCKG
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgctggatgggtcccttctggcgcgctggctggccgcggccttcgggctgacgctgctg
ctcgccgcgctgcgcccttcggccgcctacttcgggctaacaggcagtgaacccctgact
atactccctctaaccctggagaccgaggctgcagcccaagctcactacaaggcctgcgac
aggctgaagctggagcgcaagcagcgtcgcatgtgccgcagggacccgggcgtggcggag
acactggtggaggctgtgagcatgagtgccctggagtgccagtaccagttccgcttcgag
cgctggaactgcaccctggagggccgctaccgagccagcctgctcaagcgaggcttcaag
gagactgctttcctctacgccatctcttctgcgggtctgacgcatgcactagccaaggcc
tgcagtgcaggtcgcatggagcgctgcacttgtgacgaggcacctgacctggaaaaccgc
gaggcctggcagtggggcggctgtggggacaacctcaagtacagcagcaagtttgtcaag
gagttcctgggccggcggtctagcaaggatctgcgagcccgagtggacttccacaacaac
ctcgtgggtgtgaaggtaataaaggctggagtggagaccacttgcaaatgccatggcgtg
tctggctcctgcacggtgcggacctgctggcggcagctagcacccttccacgaggtgggc
aagcacctaaaacacaaatatgagacctctctcaaggtgggcagcactaccaatgaagcc
accggcgaggcgggtgccatctccccaccgcggggccgggcgtccgggtccggaggcggt
gaccccttaccccgaacaccagagctggtacacctggacgactctcccagcttctgcctg
gctggccgattttcccctggcacggcaggccgcaggtgtcaccgagagaagaactgtgag
agtatttgttgtggccgcggccacaacacacagagccgtgtggtgacaaggccctgccaa
tgccaggtccgctggtgctgctatgtggagtgcaggcagtgtacacagagagaggaggtc
tatacctgcaagggctga

KEGG   Rattus norvegicus (rat): 291678
Entry
291678            CDS       T01003                                 

Gene name
Wnt8a
Definition
(RefSeq) protein Wnt-8a precursor
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    291678 (Wnt8a)
   04390 Hippo signaling pathway
    291678 (Wnt8a)
   04150 mTOR signaling pathway
    291678 (Wnt8a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    291678 (Wnt8a)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    291678 (Wnt8a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    291678 (Wnt8a)
   05205 Proteoglycans in cancer
    291678 (Wnt8a)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    291678 (Wnt8a)
   05226 Gastric cancer
    291678 (Wnt8a)
   05217 Basal cell carcinoma
    291678 (Wnt8a)
   05224 Breast cancer
    291678 (Wnt8a)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    291678 (Wnt8a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    291678 (Wnt8a)
   05022 Pathways of neurodegeneration - multiple diseases
    291678 (Wnt8a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    291678 (Wnt8a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    291678 (Wnt8a)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Morphogens
   291678 (Wnt8a)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 291678
NCBI-ProteinID: NP_001099625
RGD: 1306312
Ensembl: ENSRNOG00000020157
UniProt: D4A9D7
Position
18
AA seq 359 aa
MVRTMGHFFMLWVAAGMCYTAFGASAWSVNNFLITGPKAYVTYTASVALGAQMGMEECKF
QFAWERWNCPEHAFQFSTHTRPRGATRETSFIHAIRSAAVMYAVTKNCSMGDLETCGCDE
SNNGKAGGHGWIWGGCSDNVEFGEKISRLFVDSLEKGKDARALMNLHNNRAGRLAVRASM
KRTCKCHGISGSCSIQTCWLQLADFRQMGNYLKAKYDRALKIETDKRQLRAGNRAEGRWA
PIEAFLPSAEAELIFLEGSPDYCNRNASLGIYGTEGRECLQNARSASRWEQRSCGRLCTE
CGLQVEERRTEAVSSCDCNFQWCCTVKCGQCRRVVNRYYCTRPAGSAGPRGTTTKSLVA
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggtcaggaccatgggacactttttcatgctgtgggtggctgcgggcatgtgttatacc
gctttcggtgcttctgcctggtcagtgaacaatttcctgataacaggtcccaaggcctat
gtgacctacaccgccagcgtggccttgggcgctcagatgggcatggaagagtgtaagttc
cagtttgcctgggagcggtggaactgtcctgagcacgctttccagttttcaacccacacc
aggccgagaggtgccacgagagagacatccttcatccatgccatccgctctgctgcagtc
atgtacgctgtcaccaagaactgtagcatgggcgacttggaaacctgtggctgtgatgag
tcaaataatgggaaagcaggtggccatggctggatctggggaggctgcagcgacaatgtg
gaattcggggaaaagatctccagactctttgtggacagtttggagaaaggaaaggatgcc
agagccctgatgaatcttcacaacaacagggctggcaggctggcagtgagggcctctatg
aaaagaacctgcaagtgtcatggcatctcaggaagctgcagcatccagacgtgttggctg
cagctggctgacttccggcagatgggaaattacctaaaggccaagtatgaccgcgcgctg
aaaattgagacggataagcgccagctcagggctggcaacagagctgaaggccgctgggct
cccatcgaggccttccttcccagcgcagaggctgagctgatcttcttagaggggtctcct
gactactgcaaccgcaatgccagcctgggcatctacggcacagaggggcgggagtgcctg
cagaacgcccgcagtgcttcccggtgggagcagcgcagctgtgggcgcctgtgcaccgag
tgtgggctgcaggtggaggagaggcgaacagaggccgtgagcagctgtgactgcaacttt
cagtggtgttgcacggtcaagtgtggccagtgcaggcgtgtggtgaacaggtactactgc
acacgccctgcaggtagtgcggggccccggggcaccaccacaaagtcacttgttgcttag

KEGG   Rattus norvegicus (rat): 293990
Entry
293990            CDS       T01003                                 

Gene name
Wnt8b
Definition
(RefSeq) protein Wnt-8b
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    293990 (Wnt8b)
   04390 Hippo signaling pathway
    293990 (Wnt8b)
   04150 mTOR signaling pathway
    293990 (Wnt8b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    293990 (Wnt8b)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    293990 (Wnt8b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    293990 (Wnt8b)
   05205 Proteoglycans in cancer
    293990 (Wnt8b)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    293990 (Wnt8b)
   05226 Gastric cancer
    293990 (Wnt8b)
   05217 Basal cell carcinoma
    293990 (Wnt8b)
   05224 Breast cancer
    293990 (Wnt8b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    293990 (Wnt8b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    293990 (Wnt8b)
   05022 Pathways of neurodegeneration - multiple diseases
    293990 (Wnt8b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    293990 (Wnt8b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    293990 (Wnt8b)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Morphogens
   293990 (Wnt8b)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 293990
NCBI-ProteinID: NP_001099829
RGD: 1307644
Ensembl: ENSRNOG00000013817
UniProt: D3ZND6
Position
1
AA seq 322 aa
MTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVH
AISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDA
LETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLK
EKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEG
RECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVT
KYFCSRAERPPRGAAHKPGKNP
NT seq 969 nt   +upstreamnt  +downstreamnt
atgactggaccaaaggcttacctggtctactccagcagtgtggcagctggcgcccagagc
gggattgaagaatgtaaataccagtttgcttgggaccgctggaattgccctgagagagcc
ttacagctgtccagccatggtggacttcggagtgctaaccgggagacggcgtttgtgcat
gctatcagttctgctggagttatgtacaccctgactagaaactgcagccttggagacttt
gacaactgtggctgtgatgactcccgaaatggacagctgggaggccaaggctggctctgg
ggaggctgcagtgacaacgtgggcttcggagaggcaatttccaagcagtttgtggacgcc
ctagagacaggacaggatgcccgggcagccatgaatctgcacaacaacgaggctggccgc
aaggcggtcaagggcaccatgaaacgcacgtgtaagtgccacggcgtgtcgggcagttgc
accacacagacctgctggttgcagttgccagagttccgggaggtaggcgcgcatctgaag
gagaagtatcacgcagcgctcaaggtggacctgctgcagggtgcgggcaacagcgcggct
ggccgcggcgccatcgccgacaccttccgttccatctctacacgcgagctggtgcatctg
gaggactccccggactactgcctggagaacaagaccctggggctgctgggcaccgagggc
cgagagtgtctgcggcgcgggcgcgccctgggccgctgggagcgccgcagctgccgccgg
ctgtgcggggactgcgggttggcggtggaggagcgccgcgccgagacagtgtccagctgc
aactgcaagtttcactggtgctgcgcagtccgctgcgagcagtgtcgccggcgggtcacc
aagtacttctgcagccgtgcggagcggccgccgagaggcgctgcgcacaaacctgggaag
aacccctaa

KEGG   Rattus norvegicus (rat): 303181
Entry
303181            CDS       T01003                                 

Gene name
Wnt3a
Definition
(RefSeq) protein Wnt-3a
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    303181 (Wnt3a)
   04390 Hippo signaling pathway
    303181 (Wnt3a)
   04150 mTOR signaling pathway
    303181 (Wnt3a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    303181 (Wnt3a)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    303181 (Wnt3a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    303181 (Wnt3a)
   05206 MicroRNAs in cancer
    303181 (Wnt3a)
   05205 Proteoglycans in cancer
    303181 (Wnt3a)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    303181 (Wnt3a)
   05226 Gastric cancer
    303181 (Wnt3a)
   05217 Basal cell carcinoma
    303181 (Wnt3a)
   05224 Breast cancer
    303181 (Wnt3a)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    303181 (Wnt3a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    303181 (Wnt3a)
   05022 Pathways of neurodegeneration - multiple diseases
    303181 (Wnt3a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    303181 (Wnt3a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    303181 (Wnt3a)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Morphogens
   303181 (Wnt3a)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 303181
NCBI-ProteinID: NP_001100475
RGD: 1308057
Ensembl: ENSRNOG00000003039
UniProt: F1M077
Position
10
AA seq 359 aa
MYNLCVVVVVVAEVLTQQLNDRALTSRVLLWSLAVGPQYSSLSTQPILCASIPGLVPKQL
RFCRNYVEIMPSVAEGVKAGIQECQHQFRGRRWNCTTVSNSLAIFGPVLDKATRESAFVH
AIASAGVAFAVTRSCAEGSAAICGCSSRLQGSPGEGWKWGGCSEDIEFGGMVSREFADAR
ENRPDARSAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRTIGDFLKD
KYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTR
DRTCNVSSHGIDGCDLLCCGRGHNARTERRREKCHCVFHWCCYVSCQECTRVYDVHTCK
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgtacaacctctgtgtggtggtggtggtggtggcagaggtgctaacacagcagcttaat
gacagggcactaacaagtcgggttcttctctggtccttggctgtgggaccccagtactcc
tcactgagcactcagcccattctctgtgccagcatcccgggtctggtgcccaagcagctg
cgcttctgcaggaactacgtggagatcatgcccagtgtggccgagggtgtcaaggcgggc
atccaagagtgccagcaccagttccgaggccggcgttggaactgcaccactgtcagcaac
agcctggccatctttggccccgttctggacaaagccacccgggagtcagcctttgtccat
gccatcgcttccgctggagtggccttcgcagtgacccggtcctgtgcagagggatcagct
gccatctgtgggtgcagcagccgcttgcagggctccccaggcgagggctggaagtggggt
ggctgtagtgaggacattgaatttggaggaatggtctctcgggagtttgccgatgccagg
gagaaccggccggatgcccgctctgccatgaaccgtcacaacaatgaggctgggcgacag
gccatcgccagtcacatgcacctcaagtgcaaatgccacggactatccggcagttgcgaa
gtgaagacctgctggtggtcgcagcctgacttccgcaccatcggggatttcctcaaggac
aagtatgacagcgcctcagagatggtggtagagaaacaccgagagtctcgtggctgggtg
gagaccttgaggccacgttacacatacttcaaggtgcccacagagcgcgacctggtctac
tacgaggcctcacctaacttctgcgagcccaaccctgaaaccggctccttcgggacgcgt
gaccgcacctgcaatgtgagctcgcatggcatagacgggtgcgacctgttgtgctgcggg
cgtgggcataacgcgcgcactgagcgacggagggagaaatgccactgtgttttccactgg
tgctgttatgtcagctgccaggagtgcacacgtgtctatgacgtgcacacctgcaagtag

KEGG   Rattus norvegicus (rat): 303586
Entry
303586            CDS       T01003                                 

Gene name
Wnt9b
Definition
(RefSeq) protein Wnt-9b precursor
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    303586 (Wnt9b)
   04390 Hippo signaling pathway
    303586 (Wnt9b)
   04150 mTOR signaling pathway
    303586 (Wnt9b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    303586 (Wnt9b)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    303586 (Wnt9b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    303586 (Wnt9b)
   05205 Proteoglycans in cancer
    303586 (Wnt9b)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    303586 (Wnt9b)
   05226 Gastric cancer
    303586 (Wnt9b)
   05217 Basal cell carcinoma
    303586 (Wnt9b)
   05224 Breast cancer
    303586 (Wnt9b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    303586 (Wnt9b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    303586 (Wnt9b)
   05022 Pathways of neurodegeneration - multiple diseases
    303586 (Wnt9b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    303586 (Wnt9b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    303586 (Wnt9b)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Morphogens
   303586 (Wnt9b)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 303586
NCBI-ProteinID: NP_001100525
RGD: 1309574
Ensembl: ENSRNOG00000003807
UniProt: D3ZFS0
Position
10
AA seq 359 aa
MRPAPALALAALCLLALPAVVAAAAYFGLTGREVLTPFPGPGTAAAPAQAGAHLKQCDLL
KLSRWQKQLCRREPGLAETLRDAAHLGLLECQFQFRQERWNCSLEGRTGLLQRGFKETAF
LYAVSAAALTHALARACSAGRMERCTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLG
PKRGSKDLRARADAHNTHVGIKAVKSGLRTTCKCHGVSGSCAVRTCWKQLSPFRETGQVL
KLRYDTAVKVSSATNEALGRLELWVPAKPGGPAKGLAPRPVDLVYMEDSPSFCRPSKYSP
GTAGRVCSRDTSCSSLCCGRGYDTQSRMVAFSCHCQVQWCCYVECQQCAQQELVYTCKR
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgcgccccgcgcccgcgctggccctggccgcgctctgcctgctggcgctgcctgccgtc
gtcgccgccgccgcctacttcggcctgaccggtcgtgaggtcctgacgcccttcccaggt
ccgggcacagcggcagctccggcacaggctggtgcccacctgaagcagtgtgacctcctg
aagctatccaggtggcagaagcagctctgcaggagggagcctggcttggccgagaccctg
cgggatgctgcacacctggggctgctggaatgccagttccagttcaggcaggagcgctgg
aactgcagcctggaggggaggaccggcctgctccagagaggcttcaaggagacagccttc
ctgtacgcggtgtctgcagctgccctcacacatgcgctggccagggcctgcagtgctggg
cgcatggagcgttgcacctgcgatgactccccaggcctggagagccggcaggcctggcag
tggggcgtgtgtggtgacaacctgaagtacagcaccaagttcctcagcaacttcctgggg
ccgaagagaggaagcaaggatctgagggcgagagctgacgcccacaacacccatgtgggc
atcaaggctgtgaagagcggcctgagaacaacctgcaagtgtcatggcgtgtcaggctcc
tgtgctgtgcggacctgctggaagcagctctccccatttcgtgagactggccaagtgctg
aagctacgctatgacacggctgtcaaagtgtccagtgctaccaatgaggccttgggccgt
ctggagctgtgggtacctgcaaaacctggtggacctgccaaagggctagcacctcggcct
gtggacctggtctacatggaagattctcccagcttctgccggcccagcaagtactctccg
ggcacagcaggcagggtgtgttctcgggacacaagctgcagcagcctgtgctgcgggcga
ggctacgacacccagagccgcatggtggctttctcctgccactgccaggtacagtggtgc
tgctacgtggagtgccagcagtgcgcacagcaggagcttgtgtatacctgcaaacgctag

KEGG   Rattus norvegicus (rat): 315196
Entry
315196            CDS       T01003                                 

Gene name
Wnt7b
Definition
(RefSeq) protein Wnt-7b
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    315196 (Wnt7b)
   04390 Hippo signaling pathway
    315196 (Wnt7b)
   04150 mTOR signaling pathway
    315196 (Wnt7b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    315196 (Wnt7b)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    315196 (Wnt7b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    315196 (Wnt7b)
   05205 Proteoglycans in cancer
    315196 (Wnt7b)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    315196 (Wnt7b)
   05226 Gastric cancer
    315196 (Wnt7b)
   05217 Basal cell carcinoma
    315196 (Wnt7b)
   05224 Breast cancer
    315196 (Wnt7b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    315196 (Wnt7b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    315196 (Wnt7b)
   05022 Pathways of neurodegeneration - multiple diseases
    315196 (Wnt7b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    315196 (Wnt7b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    315196 (Wnt7b)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Morphogens
   315196 (Wnt7b)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 315196
NCBI-ProteinID: NP_001009695
RGD: 1311441
Ensembl: ENSRNOG00000015750
UniProt: Q5NSW6
Position
7
AA seq 349 aa
MHRNFRKWIFYVFLCFGVLYVKLGALSSVVALGANIICNKIPGLAPRQRAICQSRPDAII
VIGEGAQMGIDECQHQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVT
AACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLM
NLHNNEAGRKVLEDRMKLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEV
VRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPG
ADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgcacagaaactttcgaaagtggatcttttacgtgtttctctgctttggcgtcctctac
gtgaagctcggagcattgtcatccgtggtggccctgggagccaacatcatctgcaacaag
attcctggcctggccccacggcagcgagccatctgccagagccgacccgatgccatcatc
gtgatcggggagggggcgcagatgggtatcgatgaatgccagcaccagttccgattcggc
cgctggaactgctccgccctgggcgagaagaccgtctttgggcaagagctccgagtaggg
agtcgagaggctgccttcacatacgccatcaccgcagcaggagtggcacacgctgtcacg
gcagcctgcagccagggcaatctgagcaactgtggctgtgaccgcgagaagcaaggctac
tacaaccaggcagaaggctggaagtgggggggttgctcagcagacgtccgctatggcatt
gacttttcccgccgcttcgtggatgctcgtgagatcaaaaagaatgccaggcgcctcatg
aaccttcacaacaatgaggcaggcagaaaggttctggaggaccgcatgaaactggaatgt
aagtgtcacggagtgtcgggctcatgtactaccaaaacctgctggaccaccctgcccaag
ttccgcgaggtgggccacctactcaaggagaagtacaacgcagctgtgcaggtggaggtg
gtgcgagccagccgcctgcgccagcccaccttcctgcgcatcaagcagctgcgcagctat
cagaagccgatggagacggacctggtgtacatcgagaagtcgcccaactactgcgaggag
gacgcggccacgggcagcgtaggcacgcagggccgcctttgcaaccgcacctcgccgggt
gccgacggctgtgacaccatgtgctgcggccgtggctacaacacgcaccagtacaccaag
gtgtggcagtgcaactgcaaattccactggtgttgcttcgtcaagtgcaacacgtgcagc
gagcgcaccgaggtcttcacctgcaagtga

KEGG   Rattus norvegicus (rat): 315294
Entry
315294            CDS       T01003                                 

Gene name
Wnt10b
Definition
(RefSeq) protein Wnt-10b precursor
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    315294 (Wnt10b)
   04390 Hippo signaling pathway
    315294 (Wnt10b)
   04150 mTOR signaling pathway
    315294 (Wnt10b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    315294 (Wnt10b)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    315294 (Wnt10b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    315294 (Wnt10b)
   05205 Proteoglycans in cancer
    315294 (Wnt10b)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    315294 (Wnt10b)
   05226 Gastric cancer
    315294 (Wnt10b)
   05217 Basal cell carcinoma
    315294 (Wnt10b)
   05224 Breast cancer
    315294 (Wnt10b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    315294 (Wnt10b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    315294 (Wnt10b)
   05022 Pathways of neurodegeneration - multiple diseases
    315294 (Wnt10b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    315294 (Wnt10b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    315294 (Wnt10b)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Morphogens
   315294 (Wnt10b)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 315294
NCBI-ProteinID: NP_001101581
RGD: 1304988
Ensembl: ENSRNOG00000061238
UniProt: A0A0G2K6Q8
Position
7
AA seq 389 aa
MLEEPRSRPPPLGLAGLLFLALFSRALSNEILGLKLPGEPPLTANTVCLTLSGLSKRQLG
LCLRSPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGGGRLPHHSAILKRGFRESAFS
FSMLAAGVMHAVATACSLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKSFPHSQPSP
IPGSVPGPGPQDTWEWGGCNHDMDFGEKFSRDFLDSREAPRDIQARMRIHNNRVGRQVVT
ENLKRKCKCHGTSGSCQFKTCWRAAPEFRAIGAALRERLGRAIFIDTHNRNSGVFQPRLR
PRRLSGELVYFEKSPDFCERDPALGSPGTRGRACNKTSRLLDGCGSLCCGRGHNVLRQTR
VERCHCRFHWCCYVLCDECKVTEWVNVCK
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgctggaggagccccggtctcggcctccgcccttaggcctcgcgggtctcctgttcttg
gctttgttcagtcgggctctaagcaatgagattctgggcctaaaacttcccggtgagccg
ccgctgacggccaacaccgtgtgcttgaccctgtccggcttgagtaagcggcagctgggg
ctgtgcctgcgcagccccgacgtgacggcgtccgcgctccaggggctgcacatcgccgtt
cacgagtgtcagcaccagctgcgcgaccagcgctggaactgctcggcactagagggtggc
ggccggctgccgcaccacagcgccatcctcaagcgcggtttccgtgagagtgcgttctcc
ttctccatgctggctgctggtgtcatgcacgcagttgccacagcctgcagcttgggtaag
ctggtgagctgtggctgcggctggaagggcagcggtgagcaggaccggcttcgggccaag
ttgttgcagcttcaggcactgtctaggggcaagagtttcccccactcccagcccagccct
attcctggctctgtccccggtcctggcccccaggacacgtgggaatggggtggctgtaat
cacgacatggactttggagagaagttctctcgggatttcttggattccagggaagctccc
cgggacatccaggcgagaatgcggatccacaacaacagggtggggcgccaggtggtaacc
gaaaacctgaagcggaagtgcaaatgccatggcacatcaggcagctgccaattcaagacc
tgttggagggcagccccagagttccgggccatcggggcagcactgagggagcggttgggc
agagccatcttcatcgatacccataaccgcaattctggagttttccagccccgcctacgt
ccgcgtcgtctctcaggggagctggtttactttgagaagtctcctgacttctgtgagcga
gaccccgctttgggctccccaggcacgagaggccgggcttgcaacaagaccagccgccta
ttggatggctgtggtagcctgtgctgtggccgtgggcacaacgtgctccggcagacgcga
gtggagcgctgccactgtcgtttccactggtgctgttacgtgctgtgtgatgagtgtaaa
gtcacagagtgggtcaacgtgtgtaagtga

KEGG   Rattus norvegicus (rat): 316526
Entry
316526            CDS       T01003                                 

Gene name
Wnt6
Definition
(RefSeq) protein Wnt-6 precursor
  KO
K00445  wingless-type MMTV integration site family, member 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    316526 (Wnt6)
   04390 Hippo signaling pathway
    316526 (Wnt6)
   04150 mTOR signaling pathway
    316526 (Wnt6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    316526 (Wnt6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    316526 (Wnt6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    316526 (Wnt6)
   05205 Proteoglycans in cancer
    316526 (Wnt6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    316526 (Wnt6)
   05226 Gastric cancer
    316526 (Wnt6)
   05217 Basal cell carcinoma
    316526 (Wnt6)
   05224 Breast cancer
    316526 (Wnt6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    316526 (Wnt6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    316526 (Wnt6)
   05022 Pathways of neurodegeneration - multiple diseases
    316526 (Wnt6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    316526 (Wnt6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    316526 (Wnt6)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Morphogens
   316526 (Wnt6)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 316526
NCBI-ProteinID: NP_001101696
RGD: 1304559
Ensembl: ENSRNOG00000017409
UniProt: D4A3W9
Position
9
AA seq 365 aa
MLPPVPSCLGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPE
VVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRVLQQDIRETAFVFAITAAGASHAV
TQACSMGELLQCGCQAPRGRAPPRPSGLLGTPGPPGPTGSPDASAAWEWGGCGDDVDFGD
EKSRLFMDAQHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKL
PPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRT
GSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKE
LSLCL
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgctgccgccggtgccctcctgcctcggactgctgctgctgctgctcttgtgccctgcg
cacgtcggtggactgtggtgggccgtgggcagccccctggtcatggatcctaccagcatc
tgcaggaaggccaggaggctggcaggaaggcaggctgagctgtgccaggcggagccggaa
gtagtggcagagcttgcccggggcgcaagactgggggttcgagaatgtcagttccagttc
cgtttccgacgctggaactgctccagtcacagcaaggcctttgggcgcgtcctgcagcag
gacattcgagagacagcttttgtgtttgcaattaccgctgcgggtgccagtcacgcggtc
actcaggcctgttccatgggagagctcctacagtgtggttgtcaggcaccccgcgggcgc
gcaccgcctaggccctccggccttctgggcactcctggacctccgggaccaactggctct
ccagatgccagcgcagcctgggagtggggaggctgcggagatgatgtcgactttggggat
gagaagtcaagactctttatggatgcacagcacaagcggggacgtggagatatccgtgct
ttggtgcaactgcataacaacgaggcaggcagactggcggtgcggagccacacgcgcacc
gagtgtaagtgccatgggctttcgggttcctgtgctctgcgcacctgctggcagaagctg
ccaccgttccgcgaggtgggcgcacggctgctggagcgcttccacggcgcctcacgcgtc
atgggcaccaacgacggcaaagctctgttgcctgcggtccgcaccctcaagcctcccggc
cgagccgatctcctctacgcagccgattcacccgacttctgcgcccccaaccggcgcacc
ggttcaccgggcacgcgcggccgcgcctgcaacagcagtgccccggaccttagcggctgc
gacctgttgtgctgcggtcgcggacaccgccaggagagcgtacagctcgaggagaactgc
ctgtgccgcttccactggtgctgcgtggtgcaatgccaccgctgccgcgtgcgcaaggag
ctcagcctgtgcctctga

KEGG   Rattus norvegicus (rat): 316527
Entry
316527            CDS       T01003                                 

Gene name
Wnt10a
Definition
(RefSeq) protein Wnt-10a precursor
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    316527 (Wnt10a)
   04390 Hippo signaling pathway
    316527 (Wnt10a)
   04150 mTOR signaling pathway
    316527 (Wnt10a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    316527 (Wnt10a)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    316527 (Wnt10a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    316527 (Wnt10a)
   05205 Proteoglycans in cancer
    316527 (Wnt10a)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    316527 (Wnt10a)
   05226 Gastric cancer
    316527 (Wnt10a)
   05217 Basal cell carcinoma
    316527 (Wnt10a)
   05224 Breast cancer
    316527 (Wnt10a)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    316527 (Wnt10a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    316527 (Wnt10a)
   05022 Pathways of neurodegeneration - multiple diseases
    316527 (Wnt10a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    316527 (Wnt10a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    316527 (Wnt10a)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Morphogens
   316527 (Wnt10a)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 316527
NCBI-ProteinID: NP_001101697
RGD: 1307015
Ensembl: ENSRNOG00000052510
UniProt: D3ZRW5
Position
9
AA seq 417 aa
MGSAHPRPWLRLPPGPQPRPELWALLFFLLLLAAAVPRSAPNDILGLRLPPEPVLNANTV
CLTLPGLSRRQMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKVPYES
PIFSRGFRESAFAYAIAAAGVVHAVSNACALGKLKACGCDASRRGDEEAFRRKLHRLQLD
ALQRGKGLSHGVPEHPAIPPASPGLQDSWEWGGCSPDVGFGERFSKDFLDSREPHRDIHA
RMRLHNNRVGRQAVMENMRRKCKCHGTSGSCQLKTCWQVTPEFRTVGALLRNRFHRATLI
RPHNRNGGQLEPGLAGAPSPAPGTPGLRRRASHSDLVYFEKSPDFCEREPRLDSAGTVGR
LCNKSSTGPDSCGSMCCGRGHNILRQTRSERCHCRFHWCCFVVCEECRITEWVSVCK
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgggcagcgcccaccctcgcccctggctgcggctcccaccagggccccagccgcggcct
gagctctgggcgctcctgttcttcctactgctgctggctgctgctgtgcccaggtcagca
cccaacgacatcctgggcctccgcctacccccagagcctgtgctcaacgccaacacagtg
tgcctgacattgcccggcctgagccggcggcagatggaggtgtgtgtgcgtcaccctgac
gtggccgcctctgctatccagggcatccagatcgccatccatgagtgccagcatcagttc
cgggaccagcgctggaactgttccagcctggagactcggaacaaagtcccctacgagagc
cccatcttcagcagaggttttcgagagagtgctttcgcctacgccatagcagctgccggg
gtggtgcacgcagtgtccaacgcgtgcgccctgggtaaactgaaggcttgcggttgcgat
gcctccaggcgtggggacgaagaggcctttcgtcggaagctgcaccgcttgcagctggac
gccctacagcgcggaaagggcttgagccacggggtcccggagcaccctgccataccccct
gccagcccaggcctgcaggactcctgggagtggggtggctgcagtccggatgtgggcttt
ggagaacgcttctccaaggactttctggactcccgagagcctcacagagacatccacgca
cgcatgagactccacaacaaccgtgtgggcaggcaggcggtgatggagaacatgcggcga
aagtgcaagtgccacggcacctcaggcagctgccagctcaagacctgctggcaggtgacg
ccggagttccgcacagtgggggcgctgctgcgcaaccgcttccaccgcgccacgctcatc
cggccgcacaaccgcaacggtggccagttggagcccggcctcgcgggagcaccctcgcca
gcaccgggtactccagggctgcgccgtagggccagtcactccgacctggtctactttgag
aaatcgcccgacttctgtgagcgcgagcctcgtctggactcggcaggcactgtggggcgc
ctgtgcaataagagcagcacgggtccagacagctgcggcagcatgtgctgtggccgcggt
cacaacattctgcgccagacgcgcagcgagcgctgccactgtcgtttccactggtgctgc
ttcgtggtctgcgaagaatgccgcatcactgagtgggtcagcgtctgcaagtga

KEGG   Rattus norvegicus (rat): 500047
Entry
500047            CDS       T01003                                 

Gene name
Wnt16
Definition
(RefSeq) protein Wnt-16 precursor
  KO
K01558  wingless-type MMTV integration site family, member 16
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05205  Proteoglycans in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    500047 (Wnt16)
   04390 Hippo signaling pathway
    500047 (Wnt16)
   04150 mTOR signaling pathway
    500047 (Wnt16)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    500047 (Wnt16)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    500047 (Wnt16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    500047 (Wnt16)
   05202 Transcriptional misregulation in cancer
    500047 (Wnt16)
   05205 Proteoglycans in cancer
    500047 (Wnt16)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    500047 (Wnt16)
   05226 Gastric cancer
    500047 (Wnt16)
   05217 Basal cell carcinoma
    500047 (Wnt16)
   05224 Breast cancer
    500047 (Wnt16)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    500047 (Wnt16)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    500047 (Wnt16)
   05022 Pathways of neurodegeneration - multiple diseases
    500047 (Wnt16)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    500047 (Wnt16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    500047 (Wnt16)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Morphogens
   500047 (Wnt16)
SSDB
Motif
Pfam: wnt DUF3860
Other DBs
NCBI-GeneID: 500047
NCBI-ProteinID: NP_001102693
RGD: 1562253
Ensembl: ENSRNOG00000005781
UniProt: D4A3K6
Position
4
AA seq 364 aa
MDRAALLALPSLCALWAAVLSLLPCGTQGNWMWLGIASFGVPEKLGCSGLPLNSRQKELC
KRKPYLLPSIREGARLGIQECRSQFRHERWNCMVATATSTQLATAPLFGYELSSGTKETA
FIYAIMAAGLVHSVTRSCSAGNMTECSCDTTLQNSGSASEGWHWGGCSDDVQYGMWFSRK
FLDLPVRNTTEKESKVLLAMNLHNNEAGRQAVAKLMSVDCRCHGVSGSCAVKTCWKTMSS
FEKIGYFLKDKYENSIQISDKTKRKMRRREKDQRQTPILKDDLLYVHKSPNYCVENKKLG
IPGTQGRECNRTSGGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTDV
HTCK
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggacagagcggcgctcctggccctgcccagcttgtgtgcgctgtgggcagccgtgctg
tcgctgctcccctgcggaacccagggcaactggatgtggttgggcatcgcctccttcggg
gtaccggagaagctgggctgctccggcttgccgctgaacagccgccagaaggagctgtgc
aagaggaaaccgtacctgctgcctagcatccgcgagggcgccaggctgggcattcaggag
tgcagaagccagttccgacacgagaggtggaactgtatggtcgccactgccacctccacc
cagctcgctacagctcccctctttggctatgaactgagtagcggcaccaaggagacagca
ttcatttatgccatcatggctgcaggcctggtgcactctgtaaccaggtcatgcagtgca
ggcaacatgaccgagtgttcctgtgacaccaccttgcagaacagtggctcagcgagtgaa
ggctggcactggggtggatgctctgatgatgtccagtacggcatgtggttcagcagaaag
tttctagacttacccgtcagaaacaccacagaaaaagaaagcaaagtcctgctagccatg
aatctacacaacaacgaggcagggcggcaggctgtcgccaagttaatgtctgtggactgc
cgctgccatggtgtttccggctcctgtgctgtgaaaacctgctggaaaactatgtcttct
tttgaaaagattgggtattttttaaaggataaatatgaaaacagcatccagatctcagac
aaaaccaagaggaagatgcgcaggagagaaaaagaccagaggcagacacccattctcaag
gatgacttgctatacgtccataagtctcccaactactgcgtggagaacaagaaactgggt
attcctgggacccagggcagagagtgcaaccgtacgtcaggaggcgcggatggctgtaac
ctcctctgctgtggccgaggctacaacacccacgtagtcaggcacgtggagaggtgtgag
tgtaagtttatctggtgctgttacgtccgctgcaggaggtgtgaaagcatgaccgatgtc
cacacttgtaagtaa

KEGG   Rattus norvegicus (rat): 64566
Entry
64566             CDS       T01003                                 

Gene name
Wnt5a
Definition
(RefSeq) protein Wnt-5a precursor
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04360  Axon guidance
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    64566 (Wnt5a)
   04390 Hippo signaling pathway
    64566 (Wnt5a)
   04150 mTOR signaling pathway
    64566 (Wnt5a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    64566 (Wnt5a)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    64566 (Wnt5a)
  09158 Development and regeneration
   04360 Axon guidance
    64566 (Wnt5a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    64566 (Wnt5a)
   05205 Proteoglycans in cancer
    64566 (Wnt5a)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    64566 (Wnt5a)
   05226 Gastric cancer
    64566 (Wnt5a)
   05217 Basal cell carcinoma
    64566 (Wnt5a)
   05224 Breast cancer
    64566 (Wnt5a)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    64566 (Wnt5a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    64566 (Wnt5a)
   05022 Pathways of neurodegeneration - multiple diseases
    64566 (Wnt5a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    64566 (Wnt5a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    64566 (Wnt5a)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Morphogens
   64566 (Wnt5a)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 64566
NCBI-ProteinID: NP_072153
RGD: 69250
Ensembl: ENSRNOG00000015618
UniProt: F2Z3U1
Position
16
AA seq 380 aa
MKKPIGILSPGVALGTAGGAMSSKFFLMALATFFSFAQVVIEANSWWSLGMNNPVQMSEV
YIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDN
TSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWG
GCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKC
HGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV
YIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFH
WCCYVKCKKCTEIVDQFVCK
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgaagaagcccattggaatattaagcccaggagtggctttggggaccgctggaggtgcc
atgtcttccaagttcttcctaatggctttggccacatttttctccttcgcccaggttgta
atagaagctaattcttggtggtccctaggtatgaataaccctgttcagatgtcagaagta
tacatcataggagcacagcctctctgcagccaactggcgggactttctcaaggacagaag
aaactctgccacttgtatcaggaccacatgcagtacattggagaaggcgcgaagacgggc
atcaaagagtgccagtaccagttccggcatcggagatggaactgcagcacagtggacaac
acttctgtctttggcagggtgatgcaaataggcagccgagagacagccttcacgtacgcg
gtgagcgctgctggagtggtaaatgccatgagccgagcatgtcgggaaggcgagctgtct
acctgtggttgcagccgcgcagcacgccccaaggacttacctcgggactggctgtggggc
ggttgcggggacaacatcgactatggctaccgcttcgccaaggaattcgtggacgcacga
gaaagggaacgaatccacgccaagggctcctatgagagcgcacgcatcctcatgaacttg
cacaacaatgaagcaggtcgcaggacagtatacaacctggcagatgtagcctgtaagtgc
catggagtgtctggctcctgtagcctcaagacatgctggctgcagctggcggacttccgc
aaggtgggcgatgccctcaaggagaagtatgacagcgcagcggccatgaggttgaacagc
cggggcaagctggtacaggtcaacagccgcttcaactccccaaccacgcaggacctggtc
tacatcgacccaagtccggactactgtgtgcgcaacgagagcactggctcactgggcacg
cagggacgcctgtgcaacaagacctcagaggggatggacggctgcgagctcatgtgctgt
gggcgtggctatgaccagtttaagacggtgcagaccgaacgctgccattgcaagtttcac
tggtgctgctatgtcaagtgtaaaaagtgcacggagattgtggatcagttcgtgtgcaaa
tag

KEGG   Rattus norvegicus (rat): 84426
Entry
84426             CDS       T01003                                 

Gene name
Wnt4
Definition
(RefSeq) protein Wnt-4 precursor
  KO
K00408  wingless-type MMTV integration site family, member 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04360  Axon guidance
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04919  Thyroid hormone signaling pathway
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    84426 (Wnt4)
   04390 Hippo signaling pathway
    84426 (Wnt4)
   04150 mTOR signaling pathway
    84426 (Wnt4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    84426 (Wnt4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    84426 (Wnt4)
   04916 Melanogenesis
    84426 (Wnt4)
  09158 Development and regeneration
   04360 Axon guidance
    84426 (Wnt4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    84426 (Wnt4)
   05205 Proteoglycans in cancer
    84426 (Wnt4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    84426 (Wnt4)
   05226 Gastric cancer
    84426 (Wnt4)
   05217 Basal cell carcinoma
    84426 (Wnt4)
   05224 Breast cancer
    84426 (Wnt4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    84426 (Wnt4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    84426 (Wnt4)
   05022 Pathways of neurodegeneration - multiple diseases
    84426 (Wnt4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    84426 (Wnt4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    84426 (Wnt4)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Morphogens
   84426 (Wnt4)
SSDB
Motif
Pfam: wnt MEF2_binding
Other DBs
NCBI-GeneID: 84426
NCBI-ProteinID: NP_445854
RGD: 621348
Ensembl: ENSRNOG00000013166
UniProt: Q9QXQ5
Position
5
AA seq 351 aa
MSPRSCLRSLRLLVFAVFSAAASNWLYLAKLSSVGSISEEETCEKLKGLIQRQVQMCKRN
LEVMDSVRHGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGV
AFAVTRACSSGDLEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKGAS
SSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDG
ATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDMRSGVLGTRGRTCNKTS
KAIDGCELLCCGRGFHTAHVELAERCGCRFHWCCFVKCRQCQRLVEMHTCR
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgagcccccgttcgtgcctgcggtcgctgcgactcctcgtcttcgccgtgttctcggcc
gccgcgagcaactggctgtacctggccaagctgtcatcggtgggcagcatctccgaagag
gaaacgtgcgagaagctcaaaggcctgatccagaggcaggtgcagatgtgcaaacggaac
ctcgaggtgatggactcagtgcgccatggcgcccagctggccattgaggagtgccaatac
cagttccggaaccggcgctggaactgttccacactggactccctgcctgtcttcgggaag
gtggtgacacaagggacccgggaggcggcctttgtatacgccatctcttcagcaggtgtg
gcctttgcagtgacaagagcatgcagcagtggagatctggagaagtgtggctgtgaccgg
acagtacacggggtcagcccacagggtttccagtggtcaggatgctcggacaacatcgcc
tatggcgtagccttctcacagtcctttgtagacgtccgagagagaagcaagggggcctcc
tccagccgggcactcatgaaccttcacaacaacgaggctggcaggaaggccatcctgaca
cacatgcgggtggagtgcaagtgccatggggtgtcaggctcctgtgaggtaaagacatgc
tggcgagcggtaccgcccttccgtcaggttggccacgcactaaaggagaagtttgacggc
gccacggaggtggagccacggcgcgtaggctcctcccgggcactggtaccgcgaaacgcg
cagttcaagccacatacggatgaggacctggtgtacctggagccaagtccagacttctgt
gagcaggacatgcgcagcggcgtgctaggcacgaggggccgcacttgcaacaagacgtct
aaggccattgacggctgcgagctactgtgctgtggccgcggcttccacacagcgcacgtg
gagctggcagagcgctgcggctgcaggttccactggtgctgcttcgtcaagtgccggcag
tgccagcggctcgtggagatgcacacgtgccggtga

DBGET integrated database retrieval system