KEGG   Rattus norvegicus (rat): 114517
Entry
114517            CDS       T01003                                 

Gene name
Itga6
Definition
(RefSeq) integrin alpha-6 precursor
  KO
K06485  integrin alpha 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04514  Cell adhesion molecules
rno04640  Hematopoietic cell lineage
rno04810  Regulation of actin cytoskeleton
rno05145  Toxoplasmosis
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05222  Small cell lung cancer
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    114517 (Itga6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    114517 (Itga6)
   04514 Cell adhesion molecules
    114517 (Itga6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114517 (Itga6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114517 (Itga6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    114517 (Itga6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114517 (Itga6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    114517 (Itga6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    114517 (Itga6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    114517 (Itga6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    114517 (Itga6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    114517 (Itga6)
   05414 Dilated cardiomyopathy
    114517 (Itga6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    114517 (Itga6)
   04515 Cell adhesion molecules [BR:rno04515]
    114517 (Itga6)
   04090 CD molecules [BR:rno04090]
    114517 (Itga6)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   114517 (Itga6)
  Exosomal proteins of breast milk
   114517 (Itga6)
Cell adhesion molecules [BR:rno04515]
 Integrins
  Integrin alpha subunits
   114517 (Itga6)
CD molecules [BR:rno04090]
 Proteins
  114517 (Itga6)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP FG-GAP_3 Integrin_alpha PAG
Other DBs
NCBI-GeneID: 114517
NCBI-ProteinID: NP_446177
RGD: 621633
Ensembl: ENSRNOG00000001518
UniProt: Q924W2 Q924W3
Position
3
AA seq 1073 aa
MAVAGQLCLLYLSAGLLARLSTAFNLDTREDNVIRKSGDPGSLFGFSLAMHWQLQPEDKR
LLLVGAPRAEALPLQKANRTGGLYSCDITSRGPCTRIVFDNDADPMSESKEDQWMGVTVQ
SQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNTFFDMNIFEDGPYEVG
GETDHDESLVPVPANSYLGFSLDSGKGIVSKDDITFVSGAPRANHSGAVVLLKRDMKSAH
LLLEYIFDGEGLASSFGYDVAVVDLNADGWQDIVIGAPQYFDRDGEVGGAVYVYINQQGR
WSNVKPVRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPYDDLGKVFIYHGSPTGIITK
PTQVLEGTTPFFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINILKTITVTPSR
IDLRQKSMCGSPSGICLKVKACFEYTAKPSGYNPPISILGILEAEKERRKSGLSSRVQFR
NQGSEPKYTQELTLNRQKQRACMEETLWLQENIRDKLRPIPITASVEIQEPSSRRRVNSL
PEVLPILNSNEAKTVQTDVHFLKEGCGDDNVCNSNLKLEYKFGTREGNQDKFSYLPIQKG
IPELVLKDQKDIALEITVTNGPSDPRNPRKDGDDAHEAKLIATFPDTLTYSAYRELRAFP
EKQLSCVANQNGSQADCELGNPFKRNSSVTFYLILSTTEVTFDTTDLDINLKLETTSNQD
NLAPITAKAKVVIELLLSVSGVAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEFRVINLG
KPLKNLGTATLNIQWPKEISNGKWLLYLMKVESKGLEQVVCEPHNEINFLKLKESHNSRK
KRELPEKQIDDSRKFSLFSERKYQTLNCSVNVRCVNIRCPLRGLDSKASLVLRSRLWNST
FLEEYSKLNYLDILVRASIDVTAAAQNIKLPHAGTQVRVTVFPSKTVAQYSGIAWWIILL
AVLAGILMLALLVFLLWKCGFFKRNKKDHYDATYHKAEIHTQPSDKERLTSDA
NT seq 3222 nt   +upstreamnt  +downstreamnt
atggcggtcgccggccagttgtgcttgctctacctgtccgcagggcttctggcccggctg
agcacagctttcaacctggatacccgcgaggacaacgtgatccggaaatcgggggatccc
gggagcctcttcggcttctcgctcgccatgcactggcagttgcagccggaggacaagcgg
ctgttgcttgtgggggcacctcgggcagaagcacttcccctgcagaaggcgaacagaaca
gggggcctgtacagctgtgacatcacctcccggggaccttgcacacgaattgtatttgat
aatgatgctgatcctatgtcagaaagcaaggaagaccagtggatgggagtcactgtccag
agtcaaggtccagggggcaaagtggtgacgtgtgcgcatcgatacgagaaacggcagcac
gttaacacgaagcaggagtcccgggacatcttcggaaggtgttacgtcctgagtcagaat
ctcagaattgaagatgatatggatggaggagactggagtttctgtgatggccgattgagg
ggccatgaaaaatttggctcttgtcagcaaggagtagcggctactttcactaaagacttt
cattacattgtttttggagccccagggacttacaactggaaagggatcgttcgtgtagaa
caaaagaataacactttttttgacatgaacatctttgaagatgggccctatgaagttggt
ggagagactgatcatgacgaaagtctcgtgcccgttcctgctaacagttatctaggcttt
tctctggactcagggaagggtattgtttctaaagatgacatcacttttgtatctggtgct
ccaagagccaatcacagtggggctgtagttttgctaaaaagagacatgaagtcagcacat
cttctccttgagtatatatttgatggtgaaggcctggcttcttcgtttggctatgacgtg
gcggtggtggacctcaatgcagatgggtggcaagacatcgttatcggagcgccacagtac
tttgacagggatggcgaagtcgggggtgcggtgtacgtctacattaaccagcaaggcaga
tggagtaatgtgaagccagttcgtctaaatgggaccaaagactcgatgtttggaatcgca
gtgaaaaatatcggcgatattaatcaagatggctatccggatattgctgttggagctccc
tatgacgatctggggaaggtttttatctatcatggatccccgactggcataattaccaag
ccaacacaggttcttgagggtacaacgcctttcttcggctactcaatcgctgggaacatg
gacctggacaggaattcctaccctgacgttgctgtgggttccctctcagactcagtaact
attttcagatcccggccagtgattaacattctgaaaaccatcacagtgactcctagcaga
attgacctccgccagaaatccatgtgtgggtcacctagcgggatatgcctcaaggttaaa
gcctgttttgaatatactgcgaagccctccggttataaccctccaatatcaattttgggt
attcttgaagctgaaaaagaaagaagaaagtcagggttgtcgtcaagagttcagtttcga
aaccaaggttctgagccaaagtatactcaggagctgaccctgaacaggcagaagcagcgg
gcatgcatggaggagacgctctggctgcaggaaaacatcagagacaagctgcgccccatc
cccatcacggcttctgtggagatccaggagcccagctctcgacggcgggtgaattcactt
ccagaagttcttcccatcttgaattcaaatgaagccaaaacagtgcagacagatgtccac
ttcttaaaggaaggatgtggagacgacaatgtctgtaacagcaaccttaagctagagtat
aaatttggtacccgagaaggaaatcaagacaaattctcttaccttccaattcagaaaggc
atcccagaattagtcctaaaagatcagaaagatatagctctggaaataacggtgaccaac
ggcccttctgatccaaggaatccccggaaagatggtgacgatgcccacgaagccaaactc
atcgcaacgtttccagacaccctgacatattccgcctacagagagctgagggctttccct
gagaagcagctgagctgtgttgccaaccagaatggctcccaagctgactgtgagctcgga
aatcctttcaagagaaattccagtgttactttttatctgattttaagtaccaccgaggtc
acctttgacaccacagatctggatattaatctgaagttggaaacaacaagcaatcaggat
aatttggctccaattacagcgaaagcaaaagtggttattgaattgcttttatcggtctct
ggagtcgctaagccttcgcaggtgtattttggaggtacagttgttggtgagcaggccatg
aagtctgaagatgaagtaggaagtttaatagagtatgaattcagggtgattaacttgggt
aaacctcttaaaaacctcggcacggcaaccctgaatatccagtggcccaaggagattagc
aatggcaaatggttgctttatttgatgaaggtcgaatccaaaggtttggagcaggttgtc
tgtgagccacacaatgaaataaacttcctcaagctgaaggagtctcacaactcaagaaag
aagcgggaacttcctgaaaaacagatagacgacagcaggaagttttctctattttccgaa
agaaaataccagaccctcaactgcagcgtcaacgtgaggtgtgtgaacatcaggtgtcca
ctgcgagggctggacagcaaggcctctctcgttctacgctccaggctgtggaacagcacg
tttctagaggaatattccaaactgaactacttggacatcctcgtgagggcgtccatagat
gtgaccgccgccgctcagaatatcaagctccctcatgcgggcactcaggttcgagtgacg
gtgtttccctcaaagacggtagctcagtattcagggatagcgtggtggatcatcctcctg
gctgtgcttgccgggattttgatgctggctctattagtgtttttactgtggaagtgtggt
ttcttcaagagaaataagaaagatcattacgatgccacctaccacaaggctgagatccac
actcagccgtctgataaagagaggcttacttccgatgcatag

KEGG   Rattus norvegicus (rat): 170921
Entry
170921            CDS       T01003                                 

Gene name
Itga2
Definition
(RefSeq) integrin alpha-2
  KO
K06481  integrin alpha 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04611  Platelet activation
rno04640  Hematopoietic cell lineage
rno04810  Regulation of actin cytoskeleton
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05222  Small cell lung cancer
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    170921 (Itga2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    170921 (Itga2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    170921 (Itga2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    170921 (Itga2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    170921 (Itga2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    170921 (Itga2)
   04611 Platelet activation
    170921 (Itga2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    170921 (Itga2)
   05205 Proteoglycans in cancer
    170921 (Itga2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    170921 (Itga2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    170921 (Itga2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    170921 (Itga2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    170921 (Itga2)
   05414 Dilated cardiomyopathy
    170921 (Itga2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    170921 (Itga2)
   04515 Cell adhesion molecules [BR:rno04515]
    170921 (Itga2)
   04090 CD molecules [BR:rno04090]
    170921 (Itga2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   170921 (Itga2)
  Exosomal proteins of bladder cancer cells
   170921 (Itga2)
Cell adhesion molecules [BR:rno04515]
 Integrins
  Integrin alpha subunits
   170921 (Itga2)
CD molecules [BR:rno04090]
 Proteins
  170921 (Itga2)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_2 FG-GAP_3 Integrin_alpha DUF11 HisK_sensor
Other DBs
NCBI-GeneID: 170921
NCBI-ProteinID: XP_345157
RGD: 621632
Ensembl: ENSRNOG00000058111
UniProt: A0A0G2K470
Position
2
AA seq 1178 aa
MGPGQAGGALLLQLLLLTQGLLSCLAYNVGLPGAKIFSGSSSEQFGYSVQQLTTPQGNWL
LVGSPWSGFPDNRMGDVYKCPVDLPTATCEKLNLQNSASISNVTEIKTNMSLGLTLTRNP
GTGGFLTCGPLWAHQCGNQYYATGICSDVSPDFQSLTSFSPAVQACPSLVDVVVVCDESN
SIYPWEAVKNFLEKFVQGLDIGPKKTQVALIQYANDPRVVFNLTTYKNKEDMVQATSETR
QYGGDLTNTFKAIQFARDIAYLPESGGRPGATKVMVVVTDGESHDGSKLQTVIQQCNDDE
ILRFGIAVLGYLNRNALDTKNLIKEIKAIASTPTERYFFNVADEAALLEKAGTLGEHIFS
IEGTVQGGDNFQMEMAQVGFSADYSPQNDILMLGAVGAFDWSGTVVQETSYEHLIFPKQA
FDQVLQDRNHSSFLGYSVAAISTENGVHFVAGAPRANYTGQIVLYSVNKHGNVTVIQSHR
GDQIGSYFGSVLCSVDVDKDTITDVLLVGAPMYMNDLKKEEGKVYLFTITKGVLNQHQFL
EGPEGTGNARFGSAIAALSDINMDGFNDVIVGSPVENENSGAVYIYNGHQGTIRTKYSQK
ILGSDGAFKSHLQFFGRSLDGYGDLNGDSITDVSIGALGQVVQLWSQSVADVATEASFTP
DKIILLNKEAKITLKLCFRAKFRPPGQNHQVAILFNMTLDADQYSSRVTSRGIFRENSER
FLQKTMVVSEVENCSEYHISIQKPSDVVNPLDLRVDISLEKPGTSPALEAYSETVKVFSI
PFYKECGSDGICISDLILDVRQLPALRNQPFIVSNQNKRLTFSVTLKNRGESAYNTAVLA
EFSENLFFASFSMPVDGTEVTCQIGSSQKSVTCDVGYPALKSEQQVTFTINFDFNLQNLQ
NQAAINFQAFSESQETNKADNSVSLIVPLLYDAELHLTRSTNINFYEISSDENAPSVINS
VEDIGPEFIFSLKITAGSAPVSMASVTIHIPLHTKEKNPLLYLTGIQTDKAGDISCRAEI
NPLNLPHTASPVSFKSENFRHMKELDCKTTSCSNVSCWLKDLHMKAEYFINVTTRVWNRT
FAASTFQTVQLTAAAEIDTHNPQLFVIEENAVTIPLMIMKPTEKAEVPTGVIIGSIIAGI
LLLLAMVAGLWKLGFFKRQYKKMGQNPDETDETTELNS
NT seq 3537 nt   +upstreamnt  +downstreamnt
atgggaccgggacaggcagggggcgcgcttctgctgcagctgctactgctcactcaaggt
cttttgagttgtctggcatataatgttggcctcccaggagcgaaaatattttctgggtct
tcaagtgaacagtttggctattcggtgcagcagcttacgaccccacaaggcaactggcta
ctggttggttcgccatggagtggcttccctgacaaccgaatgggagacgtgtacaagtgc
cctgttgacttacccactgccacctgtgaaaagctgaatctgcaaaattcagcaagcatc
tcaaatgttaccgagataaagaccaacatgagcctgggtttgaccctcaccaggaatccg
gggaccggcggctttctaacctgcggtcctctgtgggcacatcagtgtggaaatcagtat
tatgcaactggaatttgttctgatgtcagtccagactttcagtcgttgacaagcttctca
cctgcagttcaagcttgcccttccctcgtagatgtcgtagttgtctgtgatgaatcaaac
agtatttatccctgggaagcagtaaagaattttttggaaaagtttgtgcaaggcctggat
ataggacctaaaaagacacaggtggcgttaattcaatatgccaacgacccaagagttgtc
tttaacttgaccacttacaaaaacaaagaagatatggttcaggccacatccgagacgcgc
cagtatggtggggacctcacaaacaccttcaaggctatccaatttgcaagagacattgct
tatttaccggagtctggcgggcgcccaggtgctacaaaagtcatggtagttgtgactgat
ggggaatcccatgatgggtcgaagctgcaaactgtgatccagcaatgcaatgatgacgag
atactgaggtttggcatagcggttcttggatatttaaacagaaatgctcttgatactaaa
aatctaatcaaagaaattaaagcaatcgctagcactccaacggagaggtactttttcaat
gtggccgatgaggcggctcttctggagaaagctggcactctaggggagcacatattcagc
attgaaggcactgttcaaggaggagacaacttccagatggaaatggcacaagttggattc
agtgcagattactctcctcaaaatgatatcctgatgctaggtgcagtgggagcttttgac
tggagtggaactgttgtccaggagacatcttacgagcacttgatctttcctaaacaagcc
tttgaccaggttctgcaggatagaaatcacagttcatttttaggttactctgtggctgca
atttctactgaaaatggtgtccactttgttgctggtgctcctcgagcaaattatactggc
cagatagtgctgtacagtgttaacaagcatggcaatgtgaccgtgattcagtctcacaga
ggggaccagattggctcctattttggcagtgtgctgtgttcggtggatgtggataaagat
accattacagatgtgctcttggtaggtgctcccatgtacatgaacgacctcaagaaagaa
gaagggaaagtctacctgttcacaatcacaaagggcgtcctgaaccagcaccagtttctt
gaaggacctgaaggcactggaaatgctcggtttggttcagcaattgcagccctttcagac
atcaacatggatggctttaatgatgtgattgttggttcgcctgtagagaatgagaactct
ggagctgtgtacatctacaatggccaccagggtaccattcgcaccaagtactcccagaaa
atccttggatccgacggagcctttaagagccatctccagttctttggaaggtccctggat
ggctatggagatttaaatggggactccatcactgatgtatccattggtgctttggggcaa
gtggttcaactctggtcacaaagcgttgcagatgtggccacagaagcttcgttcactcca
gacaaaatcatattgctcaacaaggaagctaagataaccctcaaactctgcttcagagca
aagtttagacctcctgggcaaaaccaccaagtggccatcctgtttaacatgacacttgat
gctgaccaatattcatccagagtaacctccagggggatatttagagaaaatagtgagcga
ttcttgcagaagactatggttgtaagtgaagtggagaactgttctgagtaccacattagt
atacagaagccctctgatgttgtcaaccctttggatctgcgagtggacatcagtttggaa
aagccaggcactagccctgcccttgaagcctattcagaaactgtgaaagtcttcagtatc
cctttctataaagagtgtggcagcgatggaatttgcatctctgacctgatcctggatgtc
cgacagctgccagcccttagaaatcagccctttattgtcagtaaccaaaacaagaggtta
acattttcagtcacactgaaaaacagaggggaaagcgcgtacaacactgccgtcctggct
gagttttctgagaacttgttttttgcctctttctccatgccggtcgatggaacagaagta
acatgccagattggttcatcacagaaatctgttacctgtgacgtgggataccctgcctta
aagagtgagcagcaggtgacttttaccattaacttcgacttcaatcttcagaacctccag
aatcaggcggccatcaatttccaagccttcagtgagagccaagaaacaaacaaagcagac
aattcggtcagcctcatagttcctctcctgtatgacgctgaacttcacttaaccagatcc
accaacataaacttttatgaaatctcttcggatgagaatgctccttctgtcataaacagt
gttgaagatattggtcctgaattcatcttctctctcaagataacagcgggaagtgctcca
gtgagcatggcatcagtaaccatccacattcctctgcacaccaaggaaaagaacccactc
ctgtatctgaccgggatacaaacagacaaggctggcgacatcagctgcagagcagaaatt
aatccactaaacttaccacacacggcctcacccgtatctttcaagagtgaaaacttccgg
catatgaaagaattggactgcaaaaccacttcctgcagtaacgtctcctgctggctgaaa
gaccttcacatgaaagcggagtactttatcaatgtgactaccagggtttggaacaggacc
tttgctgcatcaactttccagactgtgcagctgacagcagcagccgagatcgatacgcat
aaccctcagctcttcgtgattgaagaaaatgctgtcacgattcccctcatgataatgaaa
cccaccgagaaagcagaagtgcccacaggagttatcataggaagcataattgctggaatc
cttttgctgttggctatggttgcaggcttgtggaagctcggcttcttcaaaagacaatat
aaaaaaatgggccaaaatccagatgagacggacgagaccacagaactcaacagctaa

KEGG   Rattus norvegicus (rat): 25118
Entry
25118             CDS       T01003                                 

Gene name
Itga1
Definition
(RefSeq) integrin alpha-1 precursor
  KO
K06480  integrin alpha 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04640  Hematopoietic cell lineage
rno04810  Regulation of actin cytoskeleton
rno05165  Human papillomavirus infection
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    25118 (Itga1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    25118 (Itga1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    25118 (Itga1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    25118 (Itga1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    25118 (Itga1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    25118 (Itga1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    25118 (Itga1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    25118 (Itga1)
   05414 Dilated cardiomyopathy
    25118 (Itga1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25118 (Itga1)
   04515 Cell adhesion molecules [BR:rno04515]
    25118 (Itga1)
   04090 CD molecules [BR:rno04090]
    25118 (Itga1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   25118 (Itga1)
Cell adhesion molecules [BR:rno04515]
 Integrins
  Integrin alpha subunits
   25118 (Itga1)
CD molecules [BR:rno04090]
 Proteins
  25118 (Itga1)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_3 FG-GAP_2 LYRIC DUF11 Integrin_alpha Cation_ATPase_N
Other DBs
NCBI-GeneID: 25118
NCBI-ProteinID: NP_112256
RGD: 2923
Ensembl: ENSRNOG00000053550
UniProt: P18614
Structure
PDB: 
2B2X 1CK4 1MHP

Position
2
AA seq 1180 aa
MVPRRPASLEVTVACIWLLTVILGFCVSFNVDVKNSMSFSGPVEDMFGYTVQQYENEEGK
WVLIGSPLVGQPKARTGDVYKCPVGRERAMPCVKLDLPVNTSIPNVTEIKENMTFGSTLV
TNPNGGFLACGPLYAYRCGHLHYTTGICSDVSPTFQVVNSFAPVQECSTQLDIVIVLDGS
NSIYPWESVIAFLNDLLKRMDIGPKQTQVGIVQYGENVTHEFNLNKYSSTEEVLVAANKI
GRQGGLQTMTALGIDTARKEAFTEARGARRGVKKVMVIVTDGESHDNYRLKQVIQDCEDE
NIQRFSIAILGHYNRGNLSTEKFVEEIKSIASEPTEKHFFNVSDELALVTIVKALGERIF
ALEATADQSAASFEMEMSQTGFSAHYSQDWVMLGAVGAYDWNGTVVMQKANQMVIPHNTT
FQTEPAKMNEPLASYLGYTVNSATIPGDVLYIAGQPRYNHTGQVVIYKMEDGNINILQTL
GGEQIGSYFGSVLTTIDIDKDSYTDLLLVGAPMYMGTEKEEQGKVYVYAVNQTRFEYQMS
LEPIRQTCCSSLKDNSCTKENKNEPCGARFGTAIAAVKDLNVDGFNDVVIGAPLEDDHAG
AVYIYHGSGKTIREAYAQRIPSGGDGKTLKFFGQSIHGEMDLNGDGLTDVTIGGLGGAAL
FWARDVAVVKVTMNFEPNKVNIQKKNCRVEGKETVCINATMCFHVKLKSKEDSIYEADLQ
YRVTLDSLRQISRSFFSGTQERKIQRNITVRESECIRHSFYMLDKHDFQDSVRVTLDFNL
TDPENGPVLDDALPNSVHEHIPFAKDCGNKERCISDLTLNVSTTEKSLLIVKSQHDKFNV
SLTVKNKGDSAYNTRTVVQHSPNLIFSGIEEIQKDSCESNQNITCRVGYPFLRAGETVTF
KIIFQFNTSHLSENAIIHLSATSDSEEPLESLNDNEVNISIPVKYEVGLQFYSSASEHHI
SVAANETIPEFINSTEDIGNEINVFYTIRKRGHFPMPELQLSISFPNLTADGYPVLYPIG
WSSSDNVNCRPRSLEDPFGINSGKKMTISKSEVLKRGTIQDCSSTCGVATITCSLLPSDL
SQVNVSLLLWKPTFIRAHFSSLNLTLRGELKSENSSLTLSSSNRKRELAIQISKDGLPGR
VPLWVILLSAFAGLLLLMLLILALWKIGFFKRPLKKKMEK
NT seq 3543 nt   +upstreamnt  +downstreamnt
atggtccccaggcgtcctgccagcctagaggtcactgtagcctgcatatggcttctcacg
gtcatcctaggcttctgcgtctccttcaatgttgatgtgaaaaactcaatgagtttcagt
ggcccagtagaggacatgtttggatacactgttcaacaatatgaaaacgaagaaggcaaa
tgggttcttattggttctcctttagttggccaacccaaagcaagaactggagatgtctat
aagtgtccggttgggagagagagagcaatgccttgcgtgaagttggacttgccagttaac
acatcgatccccaatgtcacagaaataaaggaaaacatgacatttggatcaactttagtc
accaacccgaatggaggatttctggcatgtgggcccttgtatgcctatagatgtggacat
ttgcattatacaactggaatatgttctgatgtcagtcctacatttcaagttgtgaactcc
tttgcccctgtacaagaatgcagcacccagctggacatagtcatcgtcctggatggctcc
aacagcatctacccctgggaaagtgtcatcgcctttttaaacgaccttcttaagaggatg
gatattggccctaagcagacacaggtcgggattgtacagtatggagagaatgtaacccat
gagttcaacctcaataagtattcatccacagaagaggtccttgtcgcagcaaacaaaata
ggccgacagggaggcctccaaacgatgacagcccttggaatagacacagccaggaaagag
gcattcactgaagctcggggtgccaggaggggagttaaaaaagtcatggttattgtgacc
gacggagaatcgcatgacaactatcgcctgaaacaggtcatccaagactgcgaggacgaa
aacattcagcgattttccatagctatccttggccactataacagggggaacttaagcact
gaaaaatttgtggaggaaataaaatcgatcgcaagcgagcccacggaaaagcacttcttc
aatgtctcggatgagttggccctggtcactattgttaaagctctgggagaaaggatattc
gctttggaagcgacagctgaccagtcagcagcttcatttgagatggaaatgtctcagact
ggcttcagtgctcactactcccaggactgggtcatgcttggagcggtgggagcctatgac
tggaacggaactgtggtcatgcagaaggctaaccagatggtcatccctcataacaccacc
tttcaaactgagcccgccaagatgaacgagcctctggcttcttatttaggttacacagtg
aactcggccaccatccctggagatgtgctctacatcgctgggcagcctcggtacaatcat
acgggccaggtcgtcatctacaagatggaggatgggaacatcaacattctgcagacactc
ggcggagagcagattggttcctactttggtagtgtcttaacaacaattgacatcgacaaa
gattcttatactgatctgcttctcgtcggggcccccatgtacatggggacagagaaagag
gaacagggcaaggtgtacgtgtacgctgtgaatcagacaaggtttgaatatcaaatgagc
ctggaaccaattaggcagacctgctgctcatccctgaaggataattcatgcacgaaagaa
aacaagaatgagccctgcggggcccgcttcggaacagcaattgctgctgtaaaagacctc
aacgtggatggatttaatgacgtcgtgattggagctccgctggaagatgaccacgcagga
gctgtgtacatttatcatggcagtggcaagaccataagggaggcgtatgcacaacgcatt
ccatcaggtggggatggcaagaccctgaaatttttcggccagtctatccacggagagatg
gatttaaatggtgacggtctgactgacgtgaccattggaggccttggtggagcagccctc
ttctgggccagagatgtggctgtagttaaagtgaccatgaattttgaacccaataaagtg
aatattcaaaagaaaaactgccgtgtggagggcaaagaaacagtgtgcataaatgctaca
atgtgttttcatgtgaaattaaagtctaaagaggactcaatttacgaggctgatctgcag
taccgtgtcacccttgattcactgaggcagatatcacggagctttttttctggaactcag
gaaaggaagattcaaagaaatatcaccgttcgagaatcagaatgcatcaggcactccttc
tacatgttggacaaacatgactttcaggactctgtgagagtgactctggattttaatctc
actgatccagaaaatggtcctgtacttgatgacgctctgccaaactcagtccacgaacac
attccctttgccaaagactgtggaaacaaggaaagatgcatttcagacctcactctgaat
gtgtccaccacagaaaagagcctgctgatcgtcaagtcccagcatgacaagttcaacgtt
agcctcaccgtcaaaaacaaaggagacagtgcgtacaacaccaggacagtggtgcagcat
tcaccaaatctgattttttcgggaattgaggagatccaaaaagatagctgtgaatctaat
caaaatatcacttgcagagttggatatcctttcctaagagcaggagaaacggttaccttc
aaaataatattccagtttaacacatcccatctctcggaaaatgcaatcattcacttaagt
gcaacaagtgacagtgaggagcccctggaatctcttaatgataatgaagtaaatatttcc
atcccagtaaaatatgaagttggactgcagttttacagttctgcgagtgaacatcacatt
tcagtcgctgccaatgagacgatccctgagtttattaactccactgaggacattgggaat
gaaattaatgtcttctatacgattagaaagagggggcatttcccaatgccagaacttcag
ctgtcaatttcattccccaatttgacggcagatggttatcctgtactgtacccaattgga
tggtcatcttcagataatgtgaactgtagaccccggagccttgaggacccctttggcatc
aactctgggaagaaaatgacaatatcgaagtctgaggttctcaaaagaggcacaatccag
gactgcagtagtacgtgtggagttgccaccatcacgtgtagcctccttccttccgacctg
agtcaagtgaatgtctcgctcctcctgtggaaaccgactttcataagagcacatttttcc
agcttaaaccttactctaagaggagaacttaagagtgaaaattcatcgctgactttaagt
agcagcaaccggaagcgagagctggctattcagatatccaaagacgggctcccaggcaga
gtgccgctgtgggttatcctcctgagcgccttcgcggggctactgctgctaatgctcctt
atattggctctgtggaagattggattcttcaaaaggccactgaagaagaaaatggagaaa
tga

KEGG   Rattus norvegicus (rat): 296456
Entry
296456            CDS       T01003                                 

Gene name
Itgav
Definition
(RefSeq) integrin alpha-V isoform X1
  KO
K06487  integrin alpha V
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04514  Cell adhesion molecules
rno04810  Regulation of actin cytoskeleton
rno04919  Thyroid hormone signaling pathway
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05222  Small cell lung cancer
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    296456 (Itgav)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    296456 (Itgav)
   04514 Cell adhesion molecules
    296456 (Itgav)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    296456 (Itgav)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    296456 (Itgav)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    296456 (Itgav)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    296456 (Itgav)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    296456 (Itgav)
   05205 Proteoglycans in cancer
    296456 (Itgav)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    296456 (Itgav)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    296456 (Itgav)
   05165 Human papillomavirus infection
    296456 (Itgav)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    296456 (Itgav)
   05410 Hypertrophic cardiomyopathy
    296456 (Itgav)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    296456 (Itgav)
   05414 Dilated cardiomyopathy
    296456 (Itgav)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    296456 (Itgav)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    296456 (Itgav)
   04515 Cell adhesion molecules [BR:rno04515]
    296456 (Itgav)
   04090 CD molecules [BR:rno04090]
    296456 (Itgav)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    296456 (Itgav)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   296456 (Itgav)
  Exosomal proteins of epithelial cells
   296456 (Itgav)
Cell adhesion molecules [BR:rno04515]
 Integrins
  Integrin alpha subunits
   296456 (Itgav)
CD molecules [BR:rno04090]
 Proteins
  296456 (Itgav)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP FG-GAP_3 Integrin_alpha LYRIC DctQ Collectrin
Other DBs
NCBI-GeneID: 296456
NCBI-ProteinID: XP_038962373
RGD: 1310613
Ensembl: ENSRNOG00000004912
Position
3
AA seq 1043 aa
MADPGRLLLRPRPGGLLLLLLGLLLPFAGSFNLDVESPAEYAGPEGSYFGFAVDFFVPST
SSRMFLLVGAPKANTTQPGIIEGGQVLKCDCSSSRRCQPIEFDSTGNRDYAKDDPLEFKS
HQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSKNIDAD
GQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIISKYDPNVYSIKYNNQLAT
RTAQAIFDDSYLGYSVAVGDFNGDGIEDFVSGVPRAARTLGMVYIYDGKNMSSLHNFTGE
QMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTK
LNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGLVYIFNGRSTGLNSVPSQI
LQGQWAAQSMPPSFGYSMKGATDVDRNGYPDLVVGAFGVDRAVLYRARPVVTVNAGLEVY
PSILNQDNKICPLPGTALKVSCFNVRFCLKADGKGTLPRKLNFQVELLLDKLKQKGAIRR
ALFLHNRSPGHSKDMTVFRGGQTQCEELVAYLRDESEFRDKLTPITIFMEYRLDQRTAAD
ATGLQPILNQFTPANVSRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLTVK
AQNQGEGAYEAELIVSIPPQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAG
TQLLAGLRFSVHQQSEMDTSVKFDLKIQSSNSFDNVSPVVSYKVDLAVLAAVEIRGVSSP
DHIFLPIPNWEYKETPETEEDVGPVVQHIYELRNNGPSSFSKAILNLQWPYKYNNNTLLY
ILHYDIDGPMNCTADTEINPLRIKTPEKNDTAAEQGGRNHLITKRDLSLSEGDVHTLGCG
TAQCLQITCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNIIEFPYKN
LPIEDLFNSTLVTTNITWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVR
PPQEEQEREQLQPHENGEGNSET
NT seq 3132 nt   +upstreamnt  +downstreamnt
atggctgatcccgggcggctgctgctacgccctcgccccggtggcctcctgctcctgctg
ctcggcctcctactgcccttcgccggctccttcaacctggacgtcgaaagccccgccgag
tacgccggccccgagggaagttacttcggattcgccgtggacttcttcgtgcccagcacg
tcctccaggatgttcctcctggtgggagccccaaaagcaaacacaacccagcctgggatt
atagaaggagggcaagttctcaaatgtgactgctcatccagccgccggtgccagcccatt
gaatttgattcaacaggcaatcgagattatgccaaagatgacccactggagtttaaatcc
caccagtggtttggagcctccgtgaggtcaaagcaggataaaatcttggcctgtgctcca
ttgtaccactggaggactgagatgaagcaggagagagagccagttggaacctgctttctt
caggatggcacaaagaccgttgagtatgctccatgcaggtcaaaaaatattgatgctgat
ggacagggattttgtcaaggaggattcagcattgattttactaaagccgacagagtactt
cttggaggtcccggcagcttttattggcagggtcagctcatttcagatcaagtggcagaa
atcatatctaaatatgacccaaatgtctacagcatcaaatataataaccaactagccaca
cggactgcacaagcaatttttgatgacagttatttgggttactctgtggccgtgggagac
ttcaatggtgacggcattgaagattttgtttctggagttccaagagcagcaaggactttg
ggaatggtttatatttatgatgggaaaaacatgtcttcattacacaattttactggtgaa
cagatggctgcatattttggattttctgtagctgctactgacattaatggggatgattat
gcagatgtgtttattggagcccctctgttcatggaccgaggttctgatggaaaactccag
gaggtcggccaggtctcagtgtctctacagagagcgtcgggagacttccagactacaaag
ctgaacgggtttgaggtttttgccagatttggaagtgccatagctcctttgggagacctg
gaccaggatggcttcaatgacattgcaattgctgctccatatggtggcgaagataaaaag
ggacttgtttatatcttcaatggaagatccacaggcttgaattcggtgccatctcaaatc
ctgcaggggcagtgggccgctcagagcatgcccccaagctttggctattcaatgaaggga
gctacagatgtagatagaaatggatatccagacttagttgtcggagcttttggtgtggac
cgagctgtcttatacagagccagacctgttgtcaccgtaaatgctggccttgaagtgtac
cctagcattttaaatcaagacaataaaatctgcccattgcctgggacagctctcaaggtt
tcctgttttaatgtcaggttctgcttaaaggcggatggcaaagggacacttccgaggaaa
ctcaacttccaggtggagcttcttttggataaactcaagcagaagggagccatccggcga
gcactgtttctccataacaggtccccggggcactctaaggacatgactgttttcaggggg
ggacagacgcagtgtgaggaactggtcgcctatcttcgggatgaatctgagtttagagac
aagctcactcccatcactatttttatggagtatcggctggaccagagaacggctgctgat
gccacaggcttgcagcccatcctgaaccagttcactccggccaacgtcagtcggcaggct
cacattttacttgactgtggcgaagacaatgtctgtaaacctaaactggaagtttctgta
gatagtgatcaaaagaagatctatattggggatgacaaccctctgaccctgaccgtgaag
gcgcagaatcaaggagaaggcgcctatgaagctgagctcatcgtttctatcccaccacag
gctgacttcatcggggttgtccggaacaacgaagccttagcaagactgtcctgtgcattt
aagacagaaaaccaaacccggcaggtggtgtgtgaccttgggaacccgatgaaggctgga
actcaactgcttgctggccttcgtttcagcgtgcaccagcaatcagagatggatacttct
gtgaagtttgacttgaaaatccaaagctctaattcttttgacaatgtcagcccagtcgtg
tcttacaaggtcgaccttgccgttttggctgccgttgagataagaggagtttcaagccca
gatcacatctttcttccaattccaaactgggagtacaaggaaacccctgagactgaagaa
gacgttgggcctgttgttcagcacatctatgagctgagaaacaatggtccaagttcattc
agcaaggcaatcctgaacctccagtggccttacaaatacaacaacaatactttgctgtac
attctccattacgacattgatgggccgatgaactgtactgccgacacagagatcaaccct
ctgagaattaagacgcccgaaaagaatgacacagcagctgagcaaggaggaagaaatcat
ctcatcaccaagcgggatctcagcctcagtgagggagatgttcacactttgggctgtgga
actgctcagtgcttgcagatcacctgccaggtcggtcgactggatagagggaagagcgcc
atcctgtacgtgaaatccctgctgtggaccgagacgtttatgaacaaggagaaccagaac
cattcctattccctgaagtcatccgcttcatttaatatcatagaattcccttacaagaat
cttccgattgaggatctcttcaactctacgctagtcaccacgaacatcacctggggcatt
cagccagcacccatgcctgtgcctgtgtgggtgatcatcttggcggttctcgcagggctg
ctgttactggccgtgttggtatttgtaatgtacaggatgggctttttcaaacgtgtccga
ccacctcaagaagagcaagaaagagaacagcttcagcctcatgagaacggcgaaggaaac
tctgaaacctaa

KEGG   Rattus norvegicus (rat): 310683
Entry
310683            CDS       T01003                                 

Gene name
Itga10
Definition
(RefSeq) integrin alpha-10 precursor
  KO
K06586  integrin alpha 10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04810  Regulation of actin cytoskeleton
rno05165  Human papillomavirus infection
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    310683 (Itga10)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    310683 (Itga10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    310683 (Itga10)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    310683 (Itga10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    310683 (Itga10)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    310683 (Itga10)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    310683 (Itga10)
   05414 Dilated cardiomyopathy
    310683 (Itga10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rno04515]
    310683 (Itga10)
Cell adhesion molecules [BR:rno04515]
 Integrins
  Integrin alpha subunits
   310683 (Itga10)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_2 FG-GAP_3
Other DBs
NCBI-GeneID: 310683
NCBI-ProteinID: NP_001101169
RGD: 1305152
Ensembl: ENSRNOG00000021217
UniProt: D3ZW82
Position
2
AA seq 1167 aa
MELPSIPHLFLPLALLTGLCSPFNLDEHHPRLFTGPPEAEFGYSVLQHVGGGQRWMLVGA
PWDGPSGDRKGDVYRCSIGGFHSAPCTKGHLGDYQLGNSSQPAVNMHLGMSLLETDADGG
FMACAPLWSRACGSSVFSSGICAHVDASFRLQGSLAPTAQRCPTYMDVVIVLDGSNSIYP
WSEVQTFLRRLVGRLFIDPEQIQVGLVQYGENPVHEWSLGDFRTKEEVVRAARNLSRREG
RETRTAQAIMVACTEGFSESRGGRPEAARLLVVVTDGESHDGEELPAALKACEAGRVTRY
GIAVLGHYLRRQRDPSSFLREIRAIASDPDERFFFNVTDEAALTDIVDALGDRIFGLEGS
RGENESSFGLEMSEIGFSIHRLQDGILFGMVGAYDWGGSVLWLEEGRRLFPPRTALEDEF
PPALQNHAAYLGYSVSSMLLPGGRRLFLSGAPRFRHRGKVIAFQLKKDGVVKVTQSLQGD
QIGSYFGSELCPLDTDMDGITNILLVAAPMFLGPQNKETGRIYVYVVGQQNLLMLQGTLQ
PDRSQDSRFGFAMAALPDLNHDGFSDVAVGAPLEDGHQGALYLYHGTQTGIRPHPTQRIA
AGSMPQALRYFGRSVDGRLDLDGDDLVDVAVGAHGAAILFSSQPIIHLIPTLDVMPPHIS
VVQKDCKRRGQEAACLTASLCFQVKSQTPGRWDRRFHIRFSASLDEWTAGARAAFDGSGQ
RLSPGQLRLSVGNVTCEQLHFHALDTSDYLRPVALTVTFALDNTTKPGPVLAEGSSTSIR
KLIPFSKDCGPDNECITDLVLQADMDIRGSRKSPFVVQGGRQKVLVSVTLENKKENAYNT
SLSLSFSRNLHLASLTPQRAKSVKVECAVPSPHARLCIVGHPVFQAGAKVSFLLEFEFSC
TFLLSQVSVRLTASSSSLERNETLQDNTAQTSAYIRYEPHLMFSSESTLHRYEVHPYRAL
PVGPGPEFKTTLRVQNLGCHVVSGLVVSALLPAVAHGGNYFLSLSQVISGNASCTVQNLT
DPPGFPVHPEELQHTSRLNGSNTRCQAVRCHLGLLPKGTEISVGLLRLVHNEFFRRAKFK
SVTVVSTFKLGTEKGSVLLLNEASQWRESHLEVIQTLPTLISLWILVGSVLGGLLLLALL
VFCLWKLGFFTRKKIPKEEQSEGKLEQ
NT seq 3504 nt   +upstreamnt  +downstreamnt
atggagcttccctccatccctcacctgttcttgccccttgcgttgctgacaggtctctgc
tccccctttaatttggatgagcatcacccacgcctattcacagggccaccagaggctgaa
tttggatacagtgtcttacagcatgttgggggtggacagcgatggatgctggtgggcgcc
ccctgggatgggccttcaggtgaccgaaagggggatgtttatcgttgctctataggggga
ttccacagtgctccatgtaccaaaggccacctgggtgactatcaactgggaaattcctct
cagcctgctgtgaatatgcacctcgggatgtctctcctggagacagatgctgatggggga
ttcatggcctgtgcccctctctggtctcgtgcctgcggcagctctgtcttcagttctgga
atatgtgcccatgtggatgcttcattccgacttcaggggagcctggcaccgaccgcccaa
cgttgtcctacatacatggatgtcgtcattgttttggatggctccaatagtatctatccc
tggtcagaagttcagactttccttcggaggctggtaggaagactgtttatcgatccagag
cagatacaggtaggactggtacagtacggggagaaccctgtgcacgagtggtccctggga
gatttccggacaaaggaagaagttgtgagagcagcgaggaacctcagtcggagggagggg
cgagaaacgagaacggcccaagcaataatggtggcatgcacagaagggttcagtgagtcc
cggggcggcagaccagaggccgctaggctgctggtagttgtcactgatggggagtctcac
gacggagaggagcttccagcagcgctaaaggcctgtgaggctggaagagtaacacgttac
gggattgcggtccttggtcactatctccggcgacagagagaccccagctcttttcttcgg
gaaatcagagccattgctagtgatccagatgagcgattcttcttcaatgtcacggatgag
gccgcgctgacggacatcgtggatgcgctgggagaccggatttttggccttgaaggatcc
cgtggagaaaatgaaagctcctttgggctagaaatgtccgagattggcttctccatccac
cggctacaggatgggattctctttgggatggtgggggcttatgactgggggggctccgtg
ctatggcttgaagaaggtcgccgccttttcccgccacgaactgccctggaagatgagttt
ccccctgcattgcagaaccacgcagcctacctgggttactctgtttcttccatgcttctg
ccgggaggacgccggctctttctctcaggggcaccgaggtttagacatcgaggaaaagtt
atcgccttccagctaaagaaagatggggttgtgaaggtcacccagagcctccagggggat
cagatcggctcatactttggcagtgagctctgcccgttggacacagatatggacggaata
actaatatcttacttgtggcggctcccatgttcctgggtccccagaacaaggagactgga
cgcatttatgtgtacgtggtgggccagcaaaatttgctgatgctccagggaacccttcag
ccagaccgctcccaggattctcggtttggctttgctatggctgctcttcctgatctgaac
cacgacggtttcagtgatgtagcagtgggggcacctctggaggatggccaccagggagca
ctgtacctgtatcacggaacccaaactggaatcaggccacatcctacccagaggattgct
gctggctccatgccacaggccctccgatattttggccgaagtgtggatggccgcctagat
ctggatggagatgatcttgtggatgttgctgtgggtgcccatggggcagccattcttttc
agctcccagcctatcatccacctgattccaaccctggatgtgatgcctccgcatatcagc
gtggttcagaaggactgtaagcgacgaggccaggaagcagcctgtttgacggcatccctt
tgcttccaagtaaagtctcaaactcctgggcgttgggatcgcagattccacatacggttc
tcagcatcactggatgagtggacagctggggcacgtgcagcattcgatggctctggccag
cggctgtccccagggcagctccggctcagtgttgggaatgtcacttgtgaacagctgcac
ttccatgcactggatacatcggattacctccggccagtggccttgactgtgacttttgct
ttggacaacaccacgaagccagggcctgtgctggctgagggatcctctacgtctatacgg
aagctgatccccttctcaaaggactgtggccctgacaatgagtgtatcacagacctggtg
cttcaagctgacatggacatcagaggctccaggaagtccccatttgtggttcaaggtggc
cgacagaaagtgctggtgtcggtgaccctggagaacaagaaggagaatgcctacaacact
agtctgagtctcagtttttctagaaacctccacctggccagtcttactcctcagagggcc
aaatcagtgaaggtggagtgtgcagtcccttccccccacgcccggctctgcatcgtgggg
catccggtcttccaggctggggccaaggtgtccttcttgttagagtttgaatttagctgc
accttcctcctgagccaggtctctgtgaggctgactgccagtagcagtagcctggagagg
aacgagacccttcaagataatacagctcagacctctgcctacatccgatacgaacctcac
ctcatgttctctagtgagtccactctgcatcggtatgaggttcatccttacagggctctc
ccagtgggccccggccctgaattcaaaaccactcttagggttcagaaccttggttgccat
gtggtcagtggtctcgttgtctcagccctccttccagctgtagcccatgggggtaactac
ttcctgtcactatctcaagtcatctctggcaatgcaagctgcacagtgcagaacctgact
gatcccccaggattccctgtgcatccagaggagcttcagcacacaagcagactgaatggc
agtaacactcggtgtcaggcggtgaggtgccatcttggactgctgcctaaggggactgag
atctctgttggactgctgaggctggttcacaatgaattcttccggagggccaagtttaag
tctgtgacagtggtcagcaccttcaagttaggaactgagaagggcagtgtcctcctactg
aacgaagcctcccagtggcgtgagagccacttggaggtgattcagaccctccctaccctc
atctccctgtggatcctggttggcagcgtcctgggagggctgctcctgcttgctctcctt
gtcttctgcctgtggaagcttggcttctttacccgcaagaaaatccccaaagaagaacaa
agtgaagggaagttggagcagtga

KEGG   Rattus norvegicus (rat): 311144
Entry
311144            CDS       T01003                                 

Gene name
Itga4
Definition
(RefSeq) integrin alpha-4
  KO
K06483  integrin alpha 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04514  Cell adhesion molecules
rno04640  Hematopoietic cell lineage
rno04670  Leukocyte transendothelial migration
rno04672  Intestinal immune network for IgA production
rno04810  Regulation of actin cytoskeleton
rno05135  Yersinia infection
rno05140  Leishmaniasis
rno05165  Human papillomavirus infection
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    311144 (Itga4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    311144 (Itga4)
   04514 Cell adhesion molecules
    311144 (Itga4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    311144 (Itga4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    311144 (Itga4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    311144 (Itga4)
   04670 Leukocyte transendothelial migration
    311144 (Itga4)
   04672 Intestinal immune network for IgA production
    311144 (Itga4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    311144 (Itga4)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    311144 (Itga4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    311144 (Itga4)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    311144 (Itga4)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    311144 (Itga4)
   05414 Dilated cardiomyopathy
    311144 (Itga4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    311144 (Itga4)
   04515 Cell adhesion molecules [BR:rno04515]
    311144 (Itga4)
   04090 CD molecules [BR:rno04090]
    311144 (Itga4)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   311144 (Itga4)
  Exosomal proteins of other cancer cells
   311144 (Itga4)
Cell adhesion molecules [BR:rno04515]
 Integrins
  Integrin alpha subunits
   311144 (Itga4)
CD molecules [BR:rno04090]
 Proteins
  311144 (Itga4)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP FG-GAP_3 Integrin_alpha
Other DBs
NCBI-GeneID: 311144
NCBI-ProteinID: NP_001101207
RGD: 1593249
Ensembl: ENSRNOG00000004861
Vega: OTTRNOG00000001285
Position
3
AA seq 1036 aa
MAAEAMCRPRPRGVALQEAVMLLLYFGVHFRVPTGHSYNLDPESALLYQGPSGTLFGYSV
VLHSHGTKRWLIVGAPTASWLANASVVNPGAIYRCRIGKNPNQICEQLQLGSPSGEPCGK
TCLEERDNQWLGVTISRQPGENGSIVTCGHRWKNIFYMKNNNKLPTGVCYGMPSDLRTEL
SKRMAPCYQDFVRKFGENFASCQAGISSFYTQDLIVMGAPGSSYWTGSVFVYNITTNKYK
AFVDRQNQVKFGSYLGYSVGAGHFRNPHTTEVVGGAPQHEQIGKAYIFSIDESELTIVYE
MKGKKLGSYFGASVCAVDLNADGFSDLLVGAPMQSTIREEGRVFVYINSGMGAVMVEMER
VLVGSDKYAARFGESMANLGDIDNDGFEDIAIGAPQEDDLRGAVYIYNGRVDGISSTYSQ
RIEGRQISQSLRMFGQSISGQIDADNNGYVDVAVGAFQSDSAVLLRTRPVVIVEASLSHP
ESVNRTKFDCTENGLLSVCVDLKLCFSYKGKEVPGYIVLFYNVSLDVHRKAESPSRFYFF
SNGTSDMITRSIRVSSSGEKCRTHQAFMRKDVRDILTPIQVEATYHLGHHVITKRNTEEF
PPLQPILQQKKEKDIIRKTINFARFCAYENCSADLQVSAKVGFLKPYENKTYLAVGSMKT
IMLNVSLFNAGDDAYETTLNVQLPTGLYFIKILDLEEKQINCDVTESSGVVKLACSLGYI
YVDRLSRIDISFLLDVSSLSRAHEDLSINVHASCENEGKLDQVKDNRVTLVIPLRYEVML
AVHGFVTPTSFVYGSSEENEPEMCMAEKLNLTFHVINTGISMAPNVSVKIMVPNSFLPRN
DKLFNVLDVQATMGQCQFEHYGRECALAQQKGIAGTLTDLVKFLSKTDKRLLYCMKADRH
CLDFLCNFGKMESGKEASVHIQLEGRPSVLEMDETSSLKFEIKATAFPEPHPKVIELNKD
ENIAHVYLEGLHHQRPKRHFTIVIVTISLLLGLIVLLLISCVMWKAGFFKRQYKSILQEE
NRRDSWSYVNSKSNDD
NT seq 3111 nt   +upstreamnt  +downstreamnt
atggctgcggaagcgatgtgcagaccgaggccccgaggggtcgccctccaggaagcggtg
atgctgttgctgtacttcggggtacacttcagggtaccaaccgggcactcctacaacctg
gacccggagagtgcactgctgtaccagggcccctccggcacgctgtttggctactcggtg
gtgctgcacagccacgggacgaagcgctggctcattgtgggggcgcccactgccagctgg
ctcgccaatgcctcggtggtcaatcctggggcgatttacagatgcaggatcggaaagaat
ccaaaccagatctgcgaacagctccagctgggaagccccagtggagaaccctgtgggaag
acgtgcttggaagagagagataatcagtggctgggagtgacaatttccagacagccagga
gaaaatggatctatcgtgacttgtgggcacaggtggaaaaatatattttacatgaagaac
aataataaactccccactggtgtttgctatggcatgccttctgatttgcggacagaacta
agtaaaaggatggccccctgttaccaagattttgtgagaaaatttggagaaaattttgca
tcgtgtcaagctggaatatctagtttttacacacaggatttgattgtgatgggggccccg
ggatcatcgtactggaccggctccgtctttgtctacaacataactacgaacaaatacaag
gcatttgtagacagacagaatcaagtaaaatttggaagctacttaggctactcagtagga
gctggtcatttccgaaatccacatactaccgaagtcgtgggaggagcccctcaacacgaa
cagataggaaaagcatatatattcagcattgatgaaagcgaactgaccatcgtatatgaa
atgaaaggtaaaaagcttggctcttactttggagcttctgtctgtgcggtggacctcaat
gcagatggcttctcagatctccttgttggagcgcctatgcagagcaccatcagggaggaa
ggaagagtgttcgtgtacatcaactctggcatgggagctgtgatggttgaaatggaaaga
gtgctcgtcggaagtgacaaatatgctgccaggtttggggaatccatggcaaatcttggc
gacattgacaatgatggctttgaagatattgctattggcgcaccacaagaagatgacttg
cgaggcgctgtctacatttacaatggccgagtagatggcatctcctctacatactcacag
agaatcgaaggacgtcaaatcagccagtcactaaggatgtttggacagtctatctcagga
caaattgatgcagacaacaatggatatgttgatgtagcggttggtgcatttcagtctgat
tctgcagtgttgctaaggacacggcctgtagtgattgttgaagcatctttaagccatcct
gagtcagtaaatagaacaaaatttgactgtactgaaaatggacttctgtctgtgtgcgtg
gatcttaaactgtgtttctcatataagggcaaagaggtcccaggctacatcgttttgttt
tacaatgtgagcttggatgtgcacaggaaggccgagtctccgtcaagattttatttcttc
tccaatgggacttctgacatgattacaagaagcatacgagtttcaagcagtggagagaaa
tgtaggacacaccaggcattcatgcggaaagacgtgcgagacatcctcactcccattcag
gttgaggccacataccaccttgggcatcatgtgatcaccaaacgaaacacagaggaattc
ccacccctccagccgatccttcagcagaagaaagaaaaagacattattagaaaaacgata
aacttcgcaaggttttgtgcctatgaaaattgttctgctgatctgcaggtttctgcaaaa
gttgggtttttgaagccatatgaaaataaaacctatcttgctgttgggagcatgaagacc
ataatgctaaatgtgtccttgttcaatgctggagatgatgcttatgaaactactctgaat
gtccaactccccacaggcctttatttcattaagatcttagacctggaagagaaacaaata
aactgcgacgtgacagagagctcaggcgtagttaagcttgcctgcagcctcggttacata
tacgtggatcgtctctcaaggatagacattagctttctcctggatgtgagctcactcagc
agggcccatgaggacctcagcatcaacgtgcatgcctcctgtgaaaatgagggtaaattg
gaccaagtgaaagacaacagagtgaccttagtgatacctctaaggtatgaagttatgctg
gctgttcacgggtttgtgaccccaacttcgtttgtgtatggatccagtgaagaaaacgag
ccagaaatgtgcatggcagagaaattgaacctcactttccatgttataaacactggcatt
agcatggctccaaatgttagtgtgaaaataatggtaccaaattcttttctccctcgaaat
gataagttgttcaacgttttggatgtccaggcaactatggggcagtgccaatttgaacac
tatggacgagagtgtgcattagcacagcaaaaaggcatagcggggaccttgaccgatttg
gtcaaatttctatcaaagactgataagagactcctgtattgcatgaaagctgatcgacac
tgtttagatttcttatgtaatttcgggaaaatggaaagtgggaaggaagccagcgttcac
attcagctggaaggcaggccatccgtcttggaaatggatgagacctcatcgctcaaattt
gaaataaaagcaacagcttttccagagccacacccaaaagttattgagctcaataaggat
gagaacattgcccatgtttacttggaagggctccatcatcaaagacccaaacggcatttc
accatcgtgattgtcaccatcagcttgctccttggacttattgtacttttattaatttca
tgtgttatgtggaaggctggattttttaaaaggcagtacaaatctatcctacaagaagaa
aacaggagagacagctggagttatgtcaacagcaaaagcaatgatgactga

KEGG   Rattus norvegicus (rat): 315346
Entry
315346            CDS       T01003                                 

Gene name
Itga5
Definition
(RefSeq) integrin alpha-5
  KO
K06484  integrin alpha 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04640  Hematopoietic cell lineage
rno04810  Regulation of actin cytoskeleton
rno05100  Bacterial invasion of epithelial cells
rno05133  Pertussis
rno05135  Yersinia infection
rno05165  Human papillomavirus infection
rno05168  Herpes simplex virus 1 infection
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    315346 (Itga5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    315346 (Itga5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    315346 (Itga5)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    315346 (Itga5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    315346 (Itga5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    315346 (Itga5)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    315346 (Itga5)
   05205 Proteoglycans in cancer
    315346 (Itga5)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    315346 (Itga5)
   05165 Human papillomavirus infection
    315346 (Itga5)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    315346 (Itga5)
   05133 Pertussis
    315346 (Itga5)
   05100 Bacterial invasion of epithelial cells
    315346 (Itga5)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    315346 (Itga5)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    315346 (Itga5)
   05414 Dilated cardiomyopathy
    315346 (Itga5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    315346 (Itga5)
   04515 Cell adhesion molecules [BR:rno04515]
    315346 (Itga5)
   04090 CD molecules [BR:rno04090]
    315346 (Itga5)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   315346 (Itga5)
Cell adhesion molecules [BR:rno04515]
 Integrins
  Integrin alpha subunits
   315346 (Itga5)
CD molecules [BR:rno04090]
 Proteins
  315346 (Itga5)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP FG-GAP_3 Integrin_alpha
Other DBs
NCBI-GeneID: 315346
NCBI-ProteinID: NP_001101588
RGD: 2925
Ensembl: ENSRNOG00000057451
UniProt: A0A0G2K1E2
Position
7
AA seq 1099 aa
MPPRQPTRRPGGGPSRELGKLLPALSHSPLGGLGSGSGSVAPGQGRTGAMGSWTPRSPRS
PLHAVLLRWGPRRLPPLLPLLLLLWPPPLQVGGFNLDAEAPAVLSGPPGSLFGFSVEFYR
PGRDGVSVLVGAPKANTSQPGVLQGGAVYVCPWGTSPIQCSTIQFDSKGSRILESSLYSE
EPVEYKSLQWFGATVRAHGSSILACAPLYSWRTEKDPQNDPVGTCYLSTENFTRILEYAP
CRSDFGSAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGQILSATQEQISESYYPQYLI
NPVQGQLQTRQASSVYDDSYLGYSVAVGEFSGDDTEDFVAGVPKGNLTYGYVTVLNGSDI
HSLYNVSGEQMASYFGYAVAATDTNGDGLDDLLVGAPLLMERTADGRPQEVGRVYIYLQH
PEGIEPTPSLTLTGQDEFGRFGSSLTPLGDLDQDGYNDVAIGAPFGGEAQQGVVFIFPGG
PGGLNTKPSQVLQPLWAAGHTPDFFGSALRGGRDLDGNGYPDLIVGSFGVDKALVYRGRP
IISASASLTIFPSMFNPEERSCSLEGNPVSCINLSFCLNASGKHVPNSIGFEVELQLDWQ
KQKGGVRRALFLASKQATLTQTLLIQNGAREDCREMKIYLRNESEFRDKLSPIHIALNFS
LDPKAPMDSHGLRPVLHYQSKSRIEDKAQILLDCGEDNICVPDLQLAVYGEKKHVYLGDK
NALNLTFLAQNLGEGGAYEAELRVTAPLEAEYSGLVRHPGNFSSLSCDYFAVNQSRQLVC
DLGNPMKAGTSIWGGLRFTVPHLQDTKKTIQFDFQILSKNLNNSQSNMVSFPLSVEAQAQ
VSLNGVSKPEAVIFPVSDWNPQDQPQKEGDLGPAVHHVYELINQGPSSISQGVLEISCPQ
ALEGQQLLYVTKVTGLNNCTSNYTPNSQGLELDPEVSPHHLQRREAPGRSSTTSGTQVLK
CPEAKCFRLRCEFGPLHRQESRSLQLHFRVWAKTFLQQEYQPFSLQCEALYEALKMPYQI
LPRQLPQKKLQVATAVQWTKAEGSNGVPLWIIILAILFGLLLLGLLIYVLYKLGFFKRSL
PYGTAMEKAQLKPPATSDA
NT seq 3300 nt   +upstreamnt  +downstreamnt
atgcccccccgccagccgacccggcggccggggggagggcccagccgggagttgggcaaa
ctcctccccgcgttgagtcattcgcctctgggaggtttaggaagcggctccgggtcggtg
gccccaggacagggaagaacgggcgctatggggagctggacgccacggtcgccacgatct
cctctccatgcggtgctgctgcgctgggggccccgacgcctaccgccgctgctgccgctg
ctgctgctactgtggccgccaccactccaggttgggggcttcaacctagacgcggaggcc
ccggcggtgctctccgggccccccggctccctctttggcttctccgtggagttttaccgg
ccgggaagggacggagtcagtgtgctggttggggcacccaaggctaacactagccaacca
ggagtactacaaggtggcgctgtctatgtgtgtccctggggcaccagtcctatccagtgc
agcaccattcaatttgacagcaaaggctcccgcatcctggagtcttcattgtatagtgag
gaacctgtggagtacaagtccttgcagtggttcggggcaacggttcgggcccacggctcc
tccatcttggcatgcgctccactgtatagctggcgcacagaaaaggacccacagaatgac
ccagtgggcacctgctacctctccacagaaaacttcacccggattctggagtatgcacct
tgccgctcagattttggcagtgcagcagggcagggttactgccaagggggcttcagtgcc
gagttcaccaagactggccgcgtggtcctaggaggacctgggagctacttctggcaaggc
cagatcctgtcggccactcaagagcagatctcggagtcctattacccacagtacctcatc
aaccctgttcaggggcagctgcagacccgccaggccagctccgtctatgatgacagctac
ttgggatactctgtggctgtaggtgaattcagtggtgatgacacagaagactttgttgct
ggcgtgcccaaaggaaacctcacctatggctatgtcactgtccttaatggctcagacatc
cactccctctacaacgtctcaggagaacagatggcctcctattttggctatgccgtagct
gccactgataccaatggagatgggctagatgacctgctggtaggggcacccctactcatg
gagcggacagctgacgggagacctcaggaggtgggcagggtctacatctatctgcagcac
ccagagggtatagagcctacgccctccctcaccctcactggccaagatgagttcggccga
ttcggcagctccttgacacccctgggggacctggaccaagacggctacaatgatgtcgcc
attggggctccgtttggtggggaggcccagcaaggagttgtatttatattcccgggaggc
ccaggaggactgaacactaagccttcccaggttttgcagcctctgtgggcagctggccat
accccagacttctttggctctgccctccgaggaggacgagatctggacggcaatggatac
cctgatctaatcgttggatcctttggtgtggacaaggctctggtatacaggggtcggccc
atcatatctgccagtgcgtctctcaccatcttcccctccatgttcaacccagaggagcgc
agctgcagcctggaaggaaaccctgtatcctgcatcaaccttagcttctgcctcaacgcc
tctggaaaacatgtacccaactctataggcttcgaggtggaactccaactggactggcag
aagcagaagggaggggtccggagggcactgttcctggcttccaagcaggccacccttacc
cagaccctgcttatccagaatggggctcgggaggactgcagggagatgaagatctacctc
aggaatgaatcagaattcagagacaaactctccccaattcacattgccctcaacttctcc
ttggaccccaaagcccccatggacagccatggcctccggccagtcctacactaccagagc
aagagccggatagaggacaaggcccagatcttgctagactgtggtgaagacaacatctgt
gtgcctgacctgcagctggctgtgtatggggagaagaaacatgtgtacctgggtgacaag
aacgccctgaacctgacattcctcgcccagaatctgggcgagggtggggcctatgaagcc
gagctgcgggtcacagcccccctggaggctgagtactcggggcttgtcagacacccaggg
aacttctccagcctgagctgtgactacttcgcggtgaaccagagccgccagctggtgtgt
gacctgggcaaccccatgaaggcaggcaccagtatctggggtggccttcggttcactgtt
cctcatcttcaagacacaaagaaaaccatccaatttgacttccagatcctcagcaagaac
ctgaacaactcacaaagcaacatggtctccttcccactctcggtggaggctcaagcccaa
gtctcccttaacggtgtctccaagcctgaagccgtgattttcccagtcagcgactggaat
cctcaagaccagcctcagaaggagggagatttgggccctgctgtccaccatgtctatgag
ctcattaaccaggggcccagctccatcagccagggtgtgctggagatcagctgtccccag
gctctggaaggccaacagctcctctatgtgaccaaggtgacgggactcaacaactgcacc
tccaactacacccccaactcacagggcctggagttggatccagaggtttctccacatcac
ctgcagaggcgagaggctccagggaggagttctaccacctcaggaacacaagtcctgaaa
tgccctgaagccaagtgtttcaggctgcgctgtgagtttgggccactgcatcgccaagag
agccggagtctgcagctgcatttccgagtctgggccaagaccttcttgcagcaggaatac
cagccgttcagccttcagtgtgaggctctatatgaagccctgaagatgccctaccaaatc
ctgcctcggcagctgccccaaaagaaactccaggtggccacagccgtgcagtggaccaag
gcagaaggcagcaatggcgtcccactgtggatcatcatcctcgccatcctttttggcctc
ctgctcctaggtctgctcatctatgtcctctacaagctcggcttcttcaaacgctccctc
ccctacggcacagccatggaaaaagctcagctcaagcctccagccacctcagatgcctga

KEGG   Rattus norvegicus (rat): 315744
Entry
315744            CDS       T01003                                 

Gene name
Itga11
Definition
(RefSeq) integrin alpha-11 precursor
  KO
K06587  integrin alpha 11
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04810  Regulation of actin cytoskeleton
rno05165  Human papillomavirus infection
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    315744 (Itga11)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    315744 (Itga11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    315744 (Itga11)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    315744 (Itga11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    315744 (Itga11)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    315744 (Itga11)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    315744 (Itga11)
   05414 Dilated cardiomyopathy
    315744 (Itga11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rno04515]
    315744 (Itga11)
Cell adhesion molecules [BR:rno04515]
 Integrins
  Integrin alpha subunits
   315744 (Itga11)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_2 FG-GAP_3 Ku_N
Other DBs
NCBI-GeneID: 315744
NCBI-ProteinID: NP_001101626
RGD: 1311711
Ensembl: ENSRNOG00000006723
Position
8
AA seq 1171 aa
MDLPRGFLVAWTLSLWPGFTDTFNMDTRNPRVIAGPSAAFFGYTVQQHDISGKKWLVVGA
PLETNGHQKTGDVYKCPVTQGNCTKLNLGRVTLSNACSPLWSHECGSSYYTTGMCSRVNS
NFRFSKTVAPALQRCQTYMDIVIVLDGSNSIYPWVEVQHFLIEILTKFYIGPGQIQVGIV
QYGEDAVHEFHLNDYKSVKDVVEAASHIEQRGGTETRTAFGIEFARSEAFQKGGRKGAKK
VMIVITDGESHDSPDLEKVIRQSEKDNVTRYAVAVLGYYNRRGINPETFLNEIKYIASDP
DDKHFFNVTDEAALKDIVDALGDRIFSLEGTNKNETSFGLEMSQTGFSSHVVEDGVLLGA
VGAYDWNGAVLKETSAGKVIPLRESYLKEFPEELKNHAAYLGYTVTSVVSSKQGRVYVAG
APRFNHTGKVILFSIHTNRSLTIHQALRGEQIGSYFGSEITSVDINNDRVTDVLLVGAPM
YFSEGRERGKVYVYNLRQNRFVFNGTLKDSHSYQNARFGSCIASVQDLNQDSYNDVVVGA
PLEDSHRGAIYIFHGFQTNILKKPVQRISASELAPGLQHFGCSIHGQLDLNEDGLVDLAV
GALGNAVVLWARPVVQINASLHFEPSKINIFHKDCKRNGRDATCLAAFLCFGPIFLAPHF
HTATVGKPASLGGIRYNATMDERRYMPRAHLDEGADQFTNRAVLLSSGQEHCQRINFHVL
DTADYVKPVAFSVEYSLEDPDHGPMLDNGWPTTLRVSVPFWNGCNEDEHCVPDLVLDARS
DLPTAMEYCQQVLRRPAQDCSSYTLSFDTTVFIIESTRRRVAVEATLENRGENAYSAVLN
ISQSENLQFASLIQKDDSDNSIECVNEERRLHKKVCNVSYPFFRAKAKVAFRLDFEFSKS
VFLHHLQIHLGAGSDSHEQDSTADDNTALLRFHLKYEADVLFTRSSSLSHFEVKANSSLE
SYDGIGPPFNCVFKVQNLGFFPIHGVMMKITVPIATRGGNRLLMLKDFFTDQVNTSCNIW
GNSTEYRSTPTEEDLSHAPQRNHSNSDVVSIICNVRLAPNQETSFYLVGNLWLMSLKALK
YRSMKITVNAALQRQFHSPFIFREEDPSRQVTFEISKQEDWQVPIWIIVGSSLGGLLLLA
LLVLALWKLGFFKSAKRKREPSLGPVPKELE
NT seq 3516 nt   +upstreamnt  +downstreamnt
atggacttgcccaggggcttcctggtggcctggaccctcagcctctggccaggattcacg
gacaccttcaacatggataccaggaatccccgggtcatcgctggtcccagtgctgctttc
tttggctacacagtacagcagcacgatatcagtggcaagaagtggttggttgtgggtgcc
ccactggaaaccaatggccaccagaagacaggagatgtatacaagtgtccagtaacccag
ggcaactgcaccaaactcaacctgggcagggtcactctgtccaatgcctgcagccctctc
tggtcacacgagtgtggaagctcctactacaccactggcatgtgctcccgggtcaactcc
aacttcagattctccaagacggtggccccggcacttcagaggtgccagacttatatggac
attgtcattgtcttggacggctccaacagcatctacccctgggtggaggtccaacacttc
ctcatcgagatcctgacaaagttctacatcggccctggccagatccaggtcggaatagtt
cagtatggagaagatgccgtccatgagttccaccttaacgactacaaatctgtaaaagat
gtggtggaagccgccagccacattgaacagagaggagggactgaaacccgcacggcattt
ggcattgaatttgcacgctcagaggctttccagaagggcggaaggaaaggggccaagaaa
gtaatgattgtcatcacggacggggaatcccacgacagcccagacctggagaaggtgatc
cggcaaagcgagaaggacaacgtgaccagatacgctgtggccgtcttgggctactacaac
cgcagggggatcaatccagagacttttctaaacgaaatcaaatacatcgccagtgaccct
gacgacaagcatttcttcaatgtcacggatgaggcggccttgaaggacattgttgatgcc
cttggggacaggatcttcagcttggaaggcaccaacaagaatgaaacctcttttggtctg
gagatgtcgcagaccggcttttcctcgcatgtggtagaggatggggtcctgctgggagct
gtgggagcctatgactggaacggggcagtgctgaaggagacaagtgcaggaaaggtgatt
cctctccgagagtcctaccttaaggagttcccggaggagttgaagaaccacgccgcatac
ctagggtacacggtgacatcggttgtgtcctccaagcaggggcgcgtgtatgtggctgga
gcccccaggttcaaccatactggcaaggtcattctgttcagtatacacaccaaccggagc
ctcaccatccaccaggctcttcggggcgagcagataggctcctacttcgggagtgagatc
acctcggtggacatcaataatgacagagtgacagatgtcctgctggtgggcgcacccatg
tacttcagcgagggccgagagagaggcaaggtgtatgtctacaacctgagacagaaccgg
tttgtttttaatggcactctgaaggattcccacagctaccagaacgcccggttcgggtca
tgcattgcctccgttcaagacctcaaccaagattcctacaatgacgtggtggtgggggcc
cctctggaggacagccacagaggggccatctacatcttccatggcttccaaaccaacatc
ctgaagaagcccgtgcagagaatatcagcctcagagctggctcccggcttgcagcatttt
ggctgcagcatccacggacaactggacctcaatgaggacgggcttgtggacctagcagtg
ggcgccctgggcaacgctgtggttttgtgggcgcgtcccgtagttcagatcaacgccagc
ctccactttgagccttccaagatcaacatcttccacaaggactgcaagcgcaatggcagg
gatgccacctgcctggctgccttcctctgcttcggacctatcttcctggcaccccacttc
cacacagcaaccgtcggtaaaccagcctccctgggcggcatcaggtacaatgcaaccatg
gatgagagacggtatatgccacgggcacatctggatgagggtgcagaccagttcaccaac
agggctgtcctactctcttctggtcaggaacactgtcaaaggatcaacttccacgtcctg
gacactgccgactacgtgaagccagtggccttctctgtggaatattccctagaggaccct
gaccatggccccatgctggacaacggctggcccactacactcagagtgtcggtgcccttc
tggaatggctgtaatgaggatgaacactgtgtccctgaccttgtactggatgctcgaagt
gatctgcccactgccatggagtactgccaacaggtgctgaggaggccggcccaggactgc
tccagttacacactgtccttcgacaccactgtcttcatcatagagagcacacggcgccgg
gtagcagtagaggccacgctggagaacagaggagagaatgcttacagtgcagtcctcaat
atctcccagtcagagaacctgcagtttgccagcctgatccagaaggatgactcagacaac
agcatcgagtgtgtgaatgaggagaggcggctacacaagaaagtctgcaacgtcagttac
cccttcttcagggccaaggccaaggtggctttccggctggatttcgagttcagcaagtct
gtgttcctgcaccatcttcagatccatctgggtgccggcagcgacagtcacgagcaggac
agcaccgcagatgacaacacggccctccttcgcttccacctcaaatatgaagcagacgtc
ctctttaccagaagcagcagcctgagccacttcgaggtcaaggccaacagctcgctggag
agctatgatggcatcgggcctccattcaactgtgttttcaaggtgcagaacctgggcttt
ttccccatccacggggtgatgatgaagattactgtgcccattgccaccaggggtggcaac
cgcctgctgatgctgaaggacttcttcacagaccaggtcaacacatcctgtaacatctgg
gggaacagcacagagtaccggagtaccccaactgaggaagacctgagccatgccccacag
aggaatcacagcaactccgatgtggtctccatcatctgcaatgtgagactagcccccaac
caggagaccagcttctacctggtggggaacctgtggctgatgtccctgaaagcactcaag
tacaggtctatgaagatcacagtcaacgccgccttgcagaggcagttccacagccccttc
atcttccgagaggaggaccccagtcgccaggtcacgtttgagatctccaagcaagaagac
tggcaggtccccatctggatcatcgtgggcagctctctgggaggcctcttgctgctggcc
ctgctggtcctggcactgtggaagcttggtttctttaaaagtgccaagcgcaagagggag
cccagcctgggccccgtccccaaagagctggagtga

KEGG   Rattus norvegicus (rat): 360606
Entry
360606            CDS       T01003                                 

Gene name
Itga3
Definition
(RefSeq) Integrin alpha-3 isoform 1
  KO
K06482  integrin alpha 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04640  Hematopoietic cell lineage
rno04810  Regulation of actin cytoskeleton
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05222  Small cell lung cancer
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    360606 (Itga3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    360606 (Itga3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    360606 (Itga3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    360606 (Itga3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    360606 (Itga3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    360606 (Itga3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    360606 (Itga3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    360606 (Itga3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    360606 (Itga3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    360606 (Itga3)
   05414 Dilated cardiomyopathy
    360606 (Itga3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    360606 (Itga3)
   04515 Cell adhesion molecules [BR:rno04515]
    360606 (Itga3)
   04090 CD molecules [BR:rno04090]
    360606 (Itga3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   360606 (Itga3)
Cell adhesion molecules [BR:rno04515]
 Integrins
  Integrin alpha subunits
   360606 (Itga3)
CD molecules [BR:rno04090]
 Proteins
  360606 (Itga3)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP FG-GAP_3 FG-GAP_2 MTABC_N
Other DBs
NCBI-GeneID: 360606
NCBI-ProteinID: NP_001101762
RGD: 1310333
Ensembl: ENSRNOG00000004276
Position
10
AA seq 1052 aa
MGPGPRRVPRDPGWMLRALALMVAASGRVAFAFNLDTKFLVVKEAVNPGSLFGYSVALHR
QTERQQRYLLLAGAPRDLAVDDDYTNRTGAVYLCPLTALKNDCERMDISEKSDPDHHIIE
DMWLGVTVASQGPAGRVLVCAHRYTKVLWSGLEDQRRMVGKCYVRGNDLQLDPGDDWQTY
HNEMCNSNTDYLQTGMCQLGTSGGFTQNTVYFGAPGAYNWKGNSYMIQRKDWDLSEYSYR
GSEDQGNLYIGYTMQVGSAILHPSEITLVTGAPRHQHMGAVFLLKQESGGDLQRRQVLKG
TQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAVYVFMNQAGTSFPDQPSLL
LHGPSRSAFGISVASIGDINQDGFQDIAVGAPFEGLGKVYIYHSSSGGLLKQPQQIIHGE
TLGLPGLATFGYSLSGKMDVDENLYPDLLVGSLSDHIVLLRARPVINILHRTLVARPAVL
DPSLCTVTSCVQVELCFAYNQSAGNPNYRRNITLAYTVEADRDRRPPRLRFARSQSSVFH
GFFSMPETHCQTLELLLMDNVRDKLRPIVITMNYSLPLRMPDRLKLGLRSLDAYPVLNQA
QAMENHTEVHFQKECGPDNKCDSNLQMRAAFVSEQLQPLSRLQYSRDTKKLFLSINVTNS
PSRQRAGEDAHEALLTLEVSSALLLSSVRPAGTCQANETNTVCELGNPFKRNQRMELLIA
FEVTGVTLHTRDLRAHLQLSTSSHQDNLQPMFLTLQVDYTLQASLSLMNHRLQSFFSGTV
MGEAAMKTVKDVGSPLKYEFQVSPVGDGLAALGTLVLGLEWPYEVTNGKWLLYPTEITIH
SNGSWPCQPHGNLVNPLNLTLSDPGVKPLSPQRRRRQLDPGGDQGPPPVTLAAAKKAKSE
TVLTCSNGRARCVWLECPLPDASNITNVTVKARVWNSTFIEDYKDFDRVRVDGWATLFLR
TSIPTINMENKTTWFSVDIDSELVEELPAEIELWLVLVAVGAGLLLLGLIIILLWKCGFF
KRARTRALYEAKRQKAEMRSQPSETERLTDDY
NT seq 3159 nt   +upstreamnt  +downstreamnt
atgggccctggcccgcgccgcgtgccccgcgaccctggctggatgctccgcgccctggct
ttgatggtggcggctagtggccgggtcgccttcgctttcaacctggacaccaaattcctg
gtggtgaaggaggcggtgaaccctggtagcctctttggctactccgtcgccctccatcgg
cagactgagcgacagcagcgctacctccttctggccggtgcaccccgagacctcgcagtg
gatgatgactacaccaaccggactggtgctgtgtacctgtgtcccctcactgccctcaag
aacgattgtgaacgcatggacatttcagagaagagtgaccctgaccatcacattattgag
gacatgtggcttggagtgactgtggccagccagggccctgcaggtagagtcctggtctgt
gcccatcggtacaccaaggtgctgtggtctgggctggaagaccagcggcgcatggtgggc
aagtgctacgtgcgtggcaacgacctacagctcgaccctggcgatgattggcagacatac
cacaacgagatgtgtaacagcaacactgactacttgcagactggcatgtgccagctgggc
accagtggcggcttcacccagaacactgtatacttcggcgcccctggtgcctacaactgg
aaaggaaacagctacatgattcagcggaaagactgggatttatctgaatacagctacagg
ggctcagaggaccagggaaacctctatattgggtacacgatgcaggtaggcagtgccatc
ctacatccctcggagatcactcttgtgacgggtgccccacggcaccaacatatgggcgct
gtcttcttgctgaaacaagagtcgggtggagacctgcagaggaggcaggtgctgaagggc
acgcaggtgggcgcttattttggcagtgccattgccctggcagacctgaacaatgatggg
tggcaggacctcctggtgggtgctccctactacttcgaacggaaagaggaggtagggggt
gccgtctatgtcttcatgaaccaggcgggaacgtccttccctgatcagccttccctcctg
ctccatggccccagtcgctctgcctttggcatctctgtagccagcattggtgacatcaac
caggatggattccaggacattgctgtgggagctccatttgagggcttgggcaaagtatac
atctaccacagcagctccggggggctcctcaagcagcctcagcagataatccacggagag
acactaggactgcctggcttggccaccttcggctactctctgagtgggaagatggatgtg
gatgaaaacttatacccagacctgctagtagggagcctgtcggaccacattgtgctgctg
cgggcccgacctgtcatcaatatcctccacaggaccttggtggccaggccagctgtgttg
gacccctcgctttgtacggttacttcctgtgttcaggtggagctgtgctttgcctacaac
cagagtgccgggaaccccaactacaggcggaacatcaccctggcttacacagtggaggct
gacagggaccgacgcccacccaggctccgattcgcccgtagccagtcgtcggtcttccat
ggcttcttctccatgccagagacacattgccagacattggagttactgctgatggacaat
gttcgtgataaactccgtcctatcgtcatcaccatgaactactccttacctttgcgcatg
cccgatcgcctcaagctgggcttacggtccctggatgcctacccggtcctcaaccaggca
caggctatggagaatcacaccgaggtccacttccagaaagagtgcgggccagacaacaag
tgcgacagcaacctgcagatgcgagccgccttcgtgtctgagcagctgcagcctctaagc
aggctccagtacagcagagacactaagaaactgttcttgagcatcaatgtgaccaattcg
ccgagccgccaacgggctggggaagatgcccatgaggcactgctcactctagaggtgtca
tccgctctgcttctgtcctccgtgcgcccggctgggacctgccaagctaacgagaccaac
accgtgtgtgagctaggaaaccccttcaaacggaaccagaggatggagctgctcatcgcc
tttgaggtcaccggggtaactttgcacacgagggaccttagggcacatctacagctgtcc
acgtcaagtcaccaggacaacttgcagcccatgttcctgactttgcaggtggactacacc
ctccaggcctcgctcagtttgatgaatcatcgactgcagagcttctttagtgggacagtg
atgggcgaggctgccatgaagactgtgaaggatgtgggaagccccctgaaatatgaattc
caggtgagcccagtgggagacgggctggcagccttgggcacactggttctaggtctggag
tggccgtatgaagttaccaatggcaagtggctgctgtaccctacggagatcaccatccac
agcaatgggtcctggccctgccagccacatggaaaccttgtcaaccctctcaaccttact
ctctctgaccctggagtcaagccactgtccccacagcgccggcggagacaactagatcca
gggggagaccagggtcctccacctgtcacgctagctgctgccaaaaaagccaagtctgag
accgtgttgacctgttccaatggccgcgcccgctgtgtgtggctggagtgcccccttcca
gatgcctccaacattaccaatgtgaccgtgaaggcacgggtgtggaacagcaccttcatt
gaggactacaaagactttgacagagtccgagtagatggctgggctaccctgttcctgaga
accagtatccctaccatcaacatggagaataagaccacatggttctccgtggacatcgac
tctgagctggtggaggagctgcccgctgagatcgagctgtggttggtgcttgtggccgtg
ggtgctgggttgctgctactgggcctcatcatcatcctgctgtggaagtgcggcttcttc
aagcgagcccgcactcgtgccctgtatgaagctaagagacagaaggctgagatgaggagc
cagccatcagagacagaaaggctgaccgacgactactga

KEGG   Rattus norvegicus (rat): 364786
Entry
364786            CDS       T01003                                 

Gene name
Itga8
Definition
(RefSeq) integrin alpha-8
  KO
K06584  integrin alpha 8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04514  Cell adhesion molecules
rno04810  Regulation of actin cytoskeleton
rno05165  Human papillomavirus infection
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    364786 (Itga8)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    364786 (Itga8)
   04514 Cell adhesion molecules
    364786 (Itga8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    364786 (Itga8)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    364786 (Itga8)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    364786 (Itga8)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    364786 (Itga8)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    364786 (Itga8)
   05414 Dilated cardiomyopathy
    364786 (Itga8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rno04515]
    364786 (Itga8)
Cell adhesion molecules [BR:rno04515]
 Integrins
  Integrin alpha subunits
   364786 (Itga8)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP FG-GAP_3 Integrin_alpha Pilin_GH LYRIC
Other DBs
NCBI-GeneID: 364786
NCBI-ProteinID: NP_001167443
RGD: 621634
Ensembl: ENSRNOG00000016538
UniProt: B5DEG1
Position
17
AA seq 1062 aa
MSARTHRGPPENWAPPFACLCCVSAVLGMLWSPVSLAFNLDVDKLTVYSGPEGSYFGYSL
DFYIPDARTASVLVGAPKANTSQPDIVEGGAVYYCPWPAERSAQCKQIPFDTTNNRKIRV
NGTKEPIEFKSNQWFGATVRAHKGKVVACAPLYHWRTLKPNPAKDPVGTCYVAIQNFSAY
AEHSPCRNSNVDPEGQGYCQAGFSLDFYKNGDLIVGGPGSFYWQGQVITVSVADIIANYS
FKDILRKLAAEKQTDVAPASYDDSYLGYSVAAGEFTGDSLQELVAGIPRGAQNFGYVSII
NSTDMTFIQNFTGEQMASYFGYTVVVSDVNNDGMDDILVGAPLFMEREFESNPREVGQVY
LYLQVSALLFQDPQVLTGTETFGRFGSSVAHLGDLNQDGYNDIAIGVPFAGKDQRGKVLI
YNGNARGLHSKPSQVLQGIWGSQTIPSGFGFSLRGDADIDKNDYPDLLVGAFGEGKVAVY
RARPVVTVDAQLLLHPMIINLENKTCQIPEFPTPVACFSLRVCASIAGQSISNTVALMAE
VQLDFLKQKGAIKRTLFLHNHQSHLIFPFVMRQQKSLHCQDFMVYLRDETEFRDKLSPIN
VSLNYSLDDSTFEDGLEVKPILNHYRENVVTEQAHILVDCGEDNLCVPDLRLSARPDKQE
IIIGDENHLMLIINARNEGEGAYEAELFVMIPEEADYVGIERNNKGLRLLSCEYKMENVT
RMVVCDLGNPMVTGTNFSLGLRFAVPRLEKTNMSINFDLQIRSSNKDNPDSNFVSVQINV
TAVAQVEIRGVSHPPQIVLPIHNWEPAEEPHKEEEVGPLVEHIYELHNIGPSTISDSILE
VGWPFSAREEFLLYVFHLQTLGPLQCQTNPEINPQDIKPAASPEDTPELSAFLRNATIPH
LVRKRDVPVVQPHRQSPAKILNCTNIDCLQISCAVGRLGGGESAVLKVRSRLWAHTFLQR
KNDPYALASLVSFEVKKIPYKEQPAKLPAGSTAIKTSVIWATPNVSFSIPLWVIILAILL
GLLVLAILTLALWKCGFFDRARPPQDEMTDREQLTSDKTPEA
NT seq 3189 nt   +upstreamnt  +downstreamnt
atgtctgcgagaacccaccggggtcccccggagaactgggcacctccgttcgcttgtctc
tgttgcgtctcggccgtgctggggatgctgtggtcccccgtgtctctggcgttcaacttg
gacgtagacaagctcacggtgtacagtggccccgagggcagctacttcggctactcgctg
gacttctacatacctgatgcgcgcacagccagtgtcttggtgggggcgcccaaagccaac
actagccagccggatatcgtagaagggggagctgtctactactgtccctggcctgcagag
aggtctgcacagtgcaagcagataccctttgacaccaccaacaacaggaaaatcagagtt
aatggaaccaaagagcctatagaatttaaatcaaaccaatggtttggagccacagtgaga
gctcacaaaggaaaagttgtggcttgtgcccctttatatcactggagaactctgaagcct
aatccagcaaaggacccggttggcacatgctatgtagcaattcagaacttcagtgcttac
gctgagcactcaccctgtcggaacagcaacgttgatcctgaaggccaaggttactgccaa
gccggcttcagtctagacttctataagaatggagaccttatagtgggaggacctggaagc
ttttactggcaaggtcaggtgatcacggtcagtgtagcagacatcattgcaaattactca
ttcaaagacattcttcgaaaactggcagcagaaaagcagacagatgtggctccagcttcc
tatgatgacagctaccttggatattcagttgctgctggagaattcactggggactctctg
caagaattggttgctggaattccaagaggagcacagaactttggatatgtctccatcatt
aactccacagatatgaccttcattcagaattttactggtgagcagatggcatcttatttc
ggatatactgttgtggtatcagatgttaacaatgatggcatggatgacatattggtcggg
gcacctctctttatggagcgagaatttgaaagtaaccctagagaagtgggtcaggtctac
ctgtacctacaagtgagcgccctcctcttccaagacccacaggtccttacgggcacagag
acttttgggagattcggtagttctgtggcccacttgggggacctgaaccaagatggatac
aatgatattgccatcggtgtgccctttgcaggcaaggatcaaagaggtaaagtcctcatt
tacaacggaaacgccagaggcttgcacagcaagccttcccaagttctgcaaggaatatgg
gggtcacagaccatcccttctggattcggcttttctctaagaggagacgcagacatagac
aagaatgattacccagatttacttgtcggggcatttggagaagggaaagtggccgtgtac
agagcaaggccagttgtaacagtggatgcccagcttctgctgcacccaatgattatcaac
cttgaaaataaaacttgccagattccagaattcccgactcctgtggcctgcttttcttta
agagtctgtgcatctatagcaggccagagcatttcaaatacagtagccctgatggccgag
gtgcagttagatttcctgaagcaaaaaggagccatcaaacggaccctcttcctccacaac
caccagtcccacctcatcttccccttcgtgatgaggcagcaaaaatccctccactgccag
gattttatggtttaccttcgagatgaaactgaattccgagataaactgtctccaatcaac
gttagcctgaactacagtttggatgattccacctttgaagatggcctggaagtgaagccg
attttgaaccactacagggagaatgtcgttactgagcaggctcacatcctggtggactgt
ggagaagacaacctctgtgttcctgacttgaggctgtcagctagaccagataagcaggag
ataattattggggatgaaaatcacctaatgctcataatcaatgcaaggaatgaaggagaa
ggagcttacgaagctgaactcttcgtcatgattcccgaagaagcagattacgttgggatc
gagcgcaacaacaagggactgaggctcctgagttgtgagtacaagatggaaaacgtaacc
aggatggtggtgtgtgaccttgggaacccgatggtgactggaacgaatttttctctgggc
ctccgatttgctgttcctcgtcttgagaaaacaaacatgagtattaacttcgatctccaa
atcagaagctccaacaaggacaatcctgacagcaatttcgtgagcgtgcaaatcaacgtc
actgccgtggctcaggtggaaatcagaggagtgtcccaccctccccaaattgttctgccc
atccacaactgggagccagcagaggagccccacaaagaggaggaagtcggtcccctggtt
gaacatatttatgagctgcacaatattggacccagcaccatcagtgacagcattctcgaa
gtgggctggccattctctgcacgggaggagttcctcctctatgtctttcatcttcaaact
ctgggacctctacaatgtcaaacaaatcctgagatcaacccgcaggatataaagcctgct
gcctccccagaggatacccctgagctcagcgccttcttaagaaatgctacaattccccat
cttgtcaggaagagggatgtgccagtggtccagccccacagacagagcccggcaaaaata
ctgaactgtaccaacattgactgcttgcaaatctcgtgtgcagtgggtcgcctgggagga
ggagaaagtgcagttctgaaggtcagatcgagattgtgggcgcacacattcctccagaga
aagaacgacccttatgctcttgcatccctggtgtcctttgaagtcaagaagataccttat
aaagagcagccagcaaaactgccagccgggagcacagcgattaagacatcggttatttgg
gccactccaaatgtctccttctcaattccactgtgggtcataatactagcgatccttctt
ggcttgctggttctggccatcttaactttagctttatggaagtgtggattctttgataga
gcaagacctcctcaggatgaaatgacagacagggaacaactgaccagtgacaagaccccg
gaggcttga

KEGG   Rattus norvegicus (rat): 685004
Entry
685004            CDS       T01003                                 

Gene name
Itga9
Definition
(RefSeq) integrin alpha-9 isoform X1
  KO
K06585  integrin alpha 9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04514  Cell adhesion molecules
rno04810  Regulation of actin cytoskeleton
rno05165  Human papillomavirus infection
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    685004 (Itga9)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    685004 (Itga9)
   04514 Cell adhesion molecules
    685004 (Itga9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    685004 (Itga9)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    685004 (Itga9)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    685004 (Itga9)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    685004 (Itga9)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    685004 (Itga9)
   05414 Dilated cardiomyopathy
    685004 (Itga9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rno04515]
    685004 (Itga9)
Cell adhesion molecules [BR:rno04515]
 Integrins
  Integrin alpha subunits
   685004 (Itga9)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP FG-GAP_3 Integrin_alpha FG-GAP_2
Other DBs
NCBI-GeneID: 685004
NCBI-ProteinID: XP_038938627
RGD: 1311191
Ensembl: ENSRNOG00000043167
Position
8
AA seq 1036 aa
MGGPAAKGTGAGGLRALLLALVAAGVPAGAYNIDAQRPVRFQGPPGSFFGYAVLEHFHDN
TRWVLVGAPKADSKYSTSVKSPGAVFKCRVHTNPDRRCTELDMARERNRGESCGKTCRGD
RDDEWMGVSLARQPKADGRVLACAHRWKNIYYETDHILPHGFCYLIPSNLQAKGRMLIPC
YEEYKKKYGEEHGSCQAGIAGFFTEELVIMGAPGSFYWAGTLKVLNLTDNTYFKLNDDAI
MNRRYTYLGYAVTAGHFSHPSVTDVVGGAPQDEGIGKVYIFRADRRSGTLIKIFQASGKK
MGSYFGSSLCAVDLNMDGLSDLLVGAPMFSEIRDEGQVTVYLNQGHGVLEEQLTLTGDAA
YNAHFGESIASLGDLDDDGFPDVAVGAPMEDDFAGTVYIYHGDAQGIVPQYSMKLSGRKI
NPILQMFGQSISGGIDMDGNGYPDVTVGAFLSDSVVLLRARPVITVDVSIFLPGSINITA
PQCHDGQQPVNCLNVTVCFRFHGKNVPGEIGLNYNLTADVAQKEKGQLPRVYFVLLGETA
GQVSERLQLTHMDEVCHHYVAHVKRRVQDVISPIVFEAAYSLGEHVIGEEDRELPDLTPV
LRWKKGQRIAQKNQTVFERNCRSEDCAADLQLRGKLLLSSVDEKTTHLALGAVKNISLNI
SISNLGDDAYDANVSFNVSRELFFINMWQKEEMGISCELLESDFLKCSVGFPFMRSKSKY
EFSVIFDTSHLSGEEEILSFIVTAQSGNMERSEALHDNTLTLTIPLVHEVDTSITGIVSP
TSFVYGESVDASNFIQLDDQECHFQPVNITLQVYNMGPSTLPGSSVSISFPSRLSPGGAE
MFQVQDMVVSQEKGNCSLQRNPTPCIIPQEQENIFHTIFAFFSKSGRKVLDCEKTGSFCL
TLHCNLSALPKEESRAIDLYMLLNTEILKKDSSSVIQFMARAKVKVEPALRVVEIANGNP
EETLVVFEALHNLEPRGYVVGWIIAISLLVGILIFLLLAVLLWKMGFFRRRYKEIIEAEK
NRKENEEAWDWVQKNQ
NT seq 3111 nt   +upstreamnt  +downstreamnt
atgggcggcccggctgcaaaggggaccggcgccggggggctccgcgcgctgctgctggcg
ctggtggccgcgggggtcccggcgggcgcctacaacatcgacgcgcagcgcccggtgcgc
ttccagggccccccgggctccttcttcggctacgcggtgctggagcacttccacgacaac
acgcgctgggtcctcgtgggtgcaccaaaggcagattctaaatacagcacttcagtaaag
tcccctggagctgtgtttaagtgtcgtgtccataccaaccctgaccggagatgcaccgag
ctggacatggctcgagagaggaatcgtggcgagtcctgtgggaagacctgcaggggagac
agggatgatgagtggatgggagtgagcctggcccggcagcccaaggcagatggccgtgtt
ttggcctgtgcccatcgttggaagaacatatactacgaaacagaccacatcttgccccat
ggattctgttacctcatcccatccaacctccaggccaaaggcaggatgctgatcccctgc
tatgaagagtataagaagaagtatggggaggaacatggctcctgccaggccgggatagca
ggcttcttcactgaggagctggtgatcatgggcgctccgggctcattttattgggcaggg
acactcaaggtgctgaatctcacagacaacacgtattttaagctgaacgatgacgctatc
atgaacagacggtatacttacctgggctatgcagtgaccgccggccatttctctcatccg
tctgtcactgacgtggtaggaggtgccccacaggatgaaggcattggaaaggtttatata
tttagagctgaccgaagatcagggaccttaataaagatcttccaggcatcagggaaaaag
atgggatcttacttcggctcctccttgtgcgcagtagacctgaacatggatggtctctcc
gacctgctcgtgggggcccccatgttttctgagatcagagatgaggggcaggtcaccgtc
tacctcaaccaaggacacggagttcttgaggaacagctgaccctgactggagatgctgcc
tacaacgcacactttggggagagcatcgccagcctgggtgaccttgatgatgacgggttc
ccagatgtggctgtcggggcgcctatggaggatgactttgctggcacagtctatatctac
catggtgatgcccaggggattgtcccccagtactcgatgaagctgtctgggaggaagata
aacccgatcctacagatgtttgggcagtccatatcggggggcattgacatggacggaaat
ggctaccctgatgtcaccgtcggagccttcctgtccgacagcgtggttctcctcagggcc
agaccggtcatcactgtggatgtctccatcttcctgccgggctccatcaacatcacagca
cctcagtgtcacgatggacagcagcctgtgaactgcctgaatgtcacggtgtgcttccga
ttccacggcaagaacgtaccaggagaaatcggtctgaactacaatctgacggctgatgtg
gcacagaaggagaagggccagctgcccagggtctattttgtgttgctgggagagactgca
gggcaggtctcggagaggctgcagctgacccacatggatgaggtgtgtcatcactacgtg
gcccacgtcaagcggagagtccaggatgtcatcagccccattgtgtttgaagctgcctac
agcctgggtgagcacgtgattggtgaggaggaccgggagctgccagacctgacaccagtg
cttcgctggaagaagggacaaaggattgctcagaagaaccagacagtctttgaaaggaat
tgccgctctgaggactgtgctgctgatctgcaacttcgggggaaactgctgctttccagt
gttgatgagaagaccacacacctggctttgggggcggtgaagaacatctctctgaacatc
tccatctccaaccttggagacgacgcctacgacgccaatgtgtccttcaatgtctccagg
gagctcttcttcatcaacatgtggcagaaggaggagatgggcatttcctgcgagctgctg
gaatcagacttcctcaagtgcagtgtgggatttcccttcatgaggtcaaagtctaagtat
gaattcagtgtcatctttgatacaagccacctgtctggagaagaggaaattctcagcttc
atcgtgactgctcagagcggcaacatggagcgctctgaagccctgcatgacaacactctc
acactgacaataccactggtgcatgaagtggacacgtccatcactggaattgtgtcccca
acctccttcgtgtatggcgagtctgtggacgcatccaacttcattcagctggatgaccag
gagtgccacttccaaccagtcaacatcactctccaggtctacaacatgggccccagcacc
cttcctgggtcttctgtcagcatctccttccccagccggctgtcacctggtggtgcagag
atgtttcaggttcaggacatggtggtgagccaagagaagggtaactgctccttacaaagg
aacccaaccccctgcatcatccctcaagaacaagaaaacatcttccacaccatatttgct
tttttctccaagtccggaagaaaagtgttggactgtgaaaagacagggagcttctgccta
acactgcactgcaaccttagcgccctccctaaagaggagagccgcgccatcgacctgtac
atgctactgaacacggagattctgaagaaggacagctcctctgtcatccagttcatggct
cgagccaaggtgaaggtggagcctgctctgagagtggtggagatagctaacgggaaccca
gaagagactctggtggtcttcgaggccttgcacaacctggaaccccgtggctacgtcgtg
ggctggatcatcgccatcagtttgctggtggggatcctcatttttctgctgctggctgtg
ctgctgtggaagatgggcttcttccgtagaaggtacaaagaaatcatcgaagctgagaaa
aaccggaaagagaatgaagaggcttgggactgggtccagaagaaccagtga

KEGG   Rattus norvegicus (rat): 685269
Entry
685269            CDS       T01003                                 

Gene name
Itga2b
Definition
(RefSeq) integrin alpha-IIb
  KO
K06476  integrin alpha 2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno04640  Hematopoietic cell lineage
rno04810  Regulation of actin cytoskeleton
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05222  Small cell lung cancer
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    685269 (Itga2b)
   04151 PI3K-Akt signaling pathway
    685269 (Itga2b)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    685269 (Itga2b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    685269 (Itga2b)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    685269 (Itga2b)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    685269 (Itga2b)
   04611 Platelet activation
    685269 (Itga2b)
   04613 Neutrophil extracellular trap formation
    685269 (Itga2b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    685269 (Itga2b)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    685269 (Itga2b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    685269 (Itga2b)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    685269 (Itga2b)
   05410 Hypertrophic cardiomyopathy
    685269 (Itga2b)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    685269 (Itga2b)
   05414 Dilated cardiomyopathy
    685269 (Itga2b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    685269 (Itga2b)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    685269 (Itga2b)
   04515 Cell adhesion molecules [BR:rno04515]
    685269 (Itga2b)
   04090 CD molecules [BR:rno04090]
    685269 (Itga2b)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     685269 (Itga2b)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   685269 (Itga2b)
Cell adhesion molecules [BR:rno04515]
 Integrins
  Integrin alpha subunits
   685269 (Itga2b)
CD molecules [BR:rno04090]
 Proteins
  685269 (Itga2b)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP FG-GAP_3 Integrin_alpha LYRIC
Other DBs
NCBI-GeneID: 685269
NCBI-ProteinID: XP_001063315
RGD: 1596428
Ensembl: ENSRNOG00000022071
Position
10
AA seq 1037 aa
MARASCAWNTLWLLQWTPLFLGPSAAPPAWALNLDSVKFSVYTGPNGSHFGFSVDFHKDS
HGSVSIVVGAPRALNANQEETGGVFLCPWKANNGTCTSLLFDLRDETRKLSLQTFQTFKT
GQGLGASVLSWNDVIVACAPWQHWNVLEKYDEAEKTPVGGCFVAELQSGGRAEYSPCRSN
TMSSVYSQGFSGDKRYCEAGFSLAVTQAGELVLGAPGGYFFLGLLVRVPIENIISSYRPG
TLLWHVSNQRFSYDSSNPVYFHGYRGYSVAVGEFDGDLSTTEYIFGAPTWSWTLGAVEIL
DSYYQTLHRLHGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRVDRKLAEVGRVYL
FLQPKGLQALSSPTLVLTGTQVYGRFGSAIAPLGDLNRDGYNDVAVAAPYGGPSGQGQVL
IFLGQSEGLSPRPSQVLDSPFPTGSGFGFSLRGSVDIDDNGYPDLIVGAYGASKVAVYRA
QPVVMATVQLMVQDSLNPTLKNCVLEQTKTPVSCFNVQMCVGATGHNIPQKLHLKAELQL
DLQKPRQARRVLLLASRQASLTLSLDLGGRNKPICHTIKAFLRDEADFRDKLSPIVLSLN
VSLPPEETGVAPAVVLHGVTHVQEQTRIILDCGEDNLCVPQLQLTATAGDSPLLIGADNV
LELKVNASNDGEGAYEAELAVHLPPGAHYIRAFSNVKGFERLVCTQKKENESRLALCELG
NPMKKDTRIGITMLVSVEILEEAGDSVSFQLQIRSKNSQNPNSEAVLLPVAVRAEAAVEL
RGNSFPASLVVAAEEVDKEQDGLDSWVSRVEHTYELHNNGPGTVNGLSLIIHLPGQSQPS
DLLYILDVQPKGGLLCSTQPPPKLLKVDRRLTTPSPSSIRRIHHDRDRREASPQGSKQTE
QQDPVLVSCNGSAPCTVVECELQEMVRGQRAMVTVQATLGLSILRQRPQEQFVLQSHAWF
NVSSLPYSVPVVSLPSGQGLVQTHLLRALEERDIPVWWVLVGVLGGLLLLTLLVLAMWKA
GFFKRNRPPLEEEEEEE
NT seq 3114 nt   +upstreamnt  +downstreamnt
atggccagagcttcatgtgcgtggaataccctgtggcttctgcagtggacaccactgttc
ctgggaccaagtgctgctcctcctgcctgggccttgaacctggactctgtgaagttctct
gtctatacaggccccaatggcagccactttggcttctcagtggactttcataaggacagc
catgggagcgtgtccatcgtggtgggcgcccccagggccctaaacgcaaatcaagaggag
actggaggtgtgttcctgtgcccctggaaggccaataacggcacatgtacctcgttgctt
ttcgacctcagggatgagacgcgaaaactaagcttgcaaactttccaaaccttcaagacc
gggcaaggacttggggcatcggtcctcagctggaatgacgtcattgtggcctgtgccccc
tggcagcactggaatgtcctagaaaagtacgatgaggcagagaagactccggtaggaggc
tgcttcgtggctgagctccaaagcgggggccgcgcagaatactcgccctgtcgctccaac
accatgagctccgtttactcacagggttttagcggagacaagcgatactgtgaagcaggc
ttcagcttggcggtgacccaggctggggagctagtgcttggggcccctggaggctacttt
tttttaggtctcctggttcgcgttccaattgagaatatcatctctagctaccgccccggt
acccttttgtggcatgtttccaaccagcgcttctcctacgactccagcaacccagtgtat
ttccacggttaccgggggtattcggtagctgtgggcgagttcgacggggatctaagcacc
acagagtatatattcggagcccccacttggagctggaccttgggagcggtggaaattttg
gactcctactaccagaccctgcacaggcttcatggagagcagatggcttcctatttcggg
cactcggtggcagtcactgacgtcaacggggatgggaggcatgacctactggtgggggct
ccattatacatggagagcagggtggaccgaaagctggccgaggtgggccgtgtatacttg
tttctgcagcctaagggtctccaggctctgagctcacccactctcgtgctgaccggcact
caggtgtatgggagatttggatctgccattgcacccctgggtgacctcaaccgagacggc
tataatgatgttgctgtggctgccccctatgggggtcccagtggtcagggccaagtgctg
atattccttggtcagagtgaagggctgagcccacgcccctcccaggtcctggacagtccc
ttcccgacaggctctggctttggcttctccctccgtggttctgtagacatcgatgacaat
ggatacccagacctgatcgtgggagcatatggggctagcaaggtagctgtgtacagagct
cagcctgtggtgatggccactgtccaactgatggttcaagactctctgaatcccacactg
aagaactgtgtcctggagcagaccaagacaccagtcagctgcttcaacgtccagatgtgc
gtgggagccacaggacacaacattccccagaagcttcacctaaaggcagagctgcagctg
gacctacagaagccccgtcaggcccgccgggtgctcctgctggcctctcgacaggcgagc
ctcactctgagcctggacctgggtggaagaaacaaacctatctgccacaccatcaaggcc
ttccttcgagatgaggccgacttccgggacaagctgagcccaattgtgctaagcctcaat
gtgtcgctgcccccagaagagactggagtagcccctgctgtggtgttgcatggagtaacc
catgtccaggagcagacacggatcatcctggactgtggggaagacaacctgtgcgtgccc
cagctccagctcacagccaccgcgggggactccccactcctaattggtgctgacaatgtg
ttggagctgaaggtcaatgcatccaatgatggcgagggggcctatgaggcagagctggct
gtgcacttacccccgggtgcccactacattcgggctttcagcaacgttaagggctttgag
aggctcgtgtgcactcagaagaaggagaatgagtccaggctggcactttgtgagctgggc
aaccccatgaaaaaggacactcggataggaatcacgatgttggtgagtgtggagatcctg
gaagaagctggagattctgtgtccttccagcttcaaatcaggagcaagaacagccagaat
ccaaacagtgaggctgtgctgttgcctgtggcagtccgagctgaagccgcagtggagctt
cgagggaactccttccctgcctccctggtggtggcagcagaagaagttgacaaggagcag
gatggtttggacagctgggtctccagggtggaacacacctatgagctccacaacaatggc
cctggcactgtgaacggcctcagtctcatcatccaccttcctggccagtcccagccctca
gatctgctctacatcctagatgtgcagccgaaggggggtctcctttgctccacacagccg
ccccccaagctcctcaaggtggaccggaggctaaccactcccagcccttcttccattcgc
cggatccatcacgaccgggaccgcagagaggcatccccgcaggggtccaagcagacggag
cagcaggacccagttctggtgagctgcaacggctcagcgccctgtacggtggtggagtgt
gaactgcaggagatggtgcgcgggcagcgggccatggtcacggtgcaggccacgctgggg
ctgtccatcctccgccagaggccccaggagcagtttgtgctgcagtcgcacgcctggttc
aacgtctcctccctaccgtactcggtgccggtggtcagcttgcccagcgggcaaggtctg
gtgcagacacatctgcttcgggccttggaggagagggacatccctgtctggtgggtgctg
gtaggcgtgctgggcggtctgctgctgctgaccctactagttttggccatgtggaaggct
ggcttcttcaagcggaatcgaccacctctggaggaagaggaagaggaagaatga

KEGG   Rattus norvegicus (rat): 81008
Entry
81008             CDS       T01003                                 

Gene name
Itga7
Definition
(RefSeq) integrin alpha-7 precursor
  KO
K06583  integrin alpha 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04810  Regulation of actin cytoskeleton
rno05165  Human papillomavirus infection
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    81008 (Itga7)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    81008 (Itga7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    81008 (Itga7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    81008 (Itga7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    81008 (Itga7)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    81008 (Itga7)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    81008 (Itga7)
   05414 Dilated cardiomyopathy
    81008 (Itga7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    81008 (Itga7)
   04515 Cell adhesion molecules [BR:rno04515]
    81008 (Itga7)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   81008 (Itga7)
Cell adhesion molecules [BR:rno04515]
 Integrins
  Integrin alpha subunits
   81008 (Itga7)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP FG-GAP_3 TgpA_N Integrin_alpha UstYa DUF4381
Other DBs
NCBI-GeneID: 81008
NCBI-ProteinID: NP_110469
RGD: 71022
Ensembl: ENSRNOG00000007905
UniProt: Q63258
Position
7
AA seq 1135 aa
MARIPRCDFLGLPGICYLLSFLLAGLLLPRASAFNLDVMGAIRKEGEPGSLFGFSVALHR
QLQPRPQSWLLVGAPQALALPGQQANRTGGLFACPLSLEETDCYRVDIDRGANVQKESKE
NQWLGVSVRSQGAGGKVVTCAHRYESRQRVDQVLETRDVIGRCFVLSQDLAIRDELDGGE
WKFCEGRPQGHEQFGFCQQGTAATFSPDSHYLIFGAPGTYNWKGLLFVTNIDSSDPDQLV
YKTLDPADRLTGPAGDLTLNSYLGFSIDSGKGLMRSEELSFVAGAPRANHKGAVVILRKD
SASRLIPEVVLSGERLTSGFGYSLAVTDLNSDGWADLIVGAPYFFERQEELGGAVYVYMN
QGGHWADISPLRLCGSPDSMFGISLAVLGDLNQDGFPDIAVGAPFDGDGKVFIYHGSSLG
VVTKPSQVLEGEAVGIKSFGYSLSGGLDVDGNHYPDLLVGSLADTAALFRARPVLHVSQE
IFIDPRAIDLEQPNCADGRLVCVHVKVCFSYVAVPSSYSPIVVLDYVLDGDTDRRLRGQA
PRVTFPGRGPDDLKHQSSGTVSLKHQHDRVCGDTVFQLQENVKDKLRAIVVTLSYGLQTP
RLRRQAPDQGLPLVAPILNAHQPSTQRTEIHFLKQGCGDDKICQSNLQLAQAQFCSRISD
TEFQALPMDLDGTALFALSGQPFIGLELTVTNLPSDPARPQADGDDAHEAQLLATLPASL
RYSGVRTLDSVEKPLCLSNENASHVECELGNPMKRGTQVTFYLILSTSGITIETTELKVE
LLLATISEQDLHPVSVRAHVFIELPLSISGVATPQQLFFSGKVKGESAMRSERDVGSKVK
YEVTVSNQGQSLNTLGSAFLNIMWPHEIANGKWLLYPMRVELEGGQGPEKKGICSPRPNI
LHLDVDSRDRRRRELGQPEPQEPPEKVEPSTSWWPVSSAEKRNVTLDCAQGTAKCVVFSC
PLYSFDRAAVLHVWGRLWNSTFLEEYMSVKSLEVIVRANITVKSSIKNLLLRDASTVIPV
MVYLDPVAVVAEGVPWWVILLAVLAGLLVLALLVLLLWKLGFFKRAKHPEATVPQYHAVK
ILREDRQQFKEEKTGTIQRSNWGNSQWEGSDAHPILAADWHPELGPDGHPVSVTA
NT seq 3408 nt   +upstreamnt  +downstreamnt
atggccaggattccgaggtgcgatttcctcgggctccccggaatttgctaccttcttagt
ttcttgcttgccggactgctcttaccacgggctagcgccttcaatctggatgtgatgggt
gccatacgcaaggagggagaacctggcagcttattcggcttttcggtggccctacaccga
caattacagccccgaccccagagctggctgctggtgggtgccccccaggccctggctctt
cccggacagcaggcaaatcgcacgggaggcctctttgcttgtcccctgagcctagaggag
acagactgctacagagtggacatcgacaggggagctaatgtgcagaaggaaagcaaggag
aaccagtggctgggagtcagcgtgcggagccagggagccgggggcaaggttgttacctgt
gcacaccgatatgagtctcgacagagagtggaccaggttttggagactcgggatgtgatt
ggtcgttgctttgtgctgagccaggacctggccatccgtgatgagttggatggtggggag
tggaagttctgtgaagggcgcccccagggccacgaacaatttgggttctgccagcagggc
acagctgccaccttctcccccgacagccactacctcatttttggggctccaggaacctat
aactggaaggggttgctttttgtgaccaacattgatagctcagaccccgaccagctggtg
tataaaactttggaccccgctgaccggctcacaggaccagccggagacttgaccttgaat
agctatttaggtttctccattgattctgggaagggtctcatgcgctcagaagagctgagt
tttgtggcaggggccccacgtgccaaccacaaaggggctgtggtcattctgcgcaaggat
agtgccagccgcctgattcctgaggttgtgctgtctggggagcgcctgacctctggcttt
ggctactccctggctgtgactgacctcaacagtgatggctgggcagacctgattgtgggt
gctccctacttctttgaacgccaagaagaacttggaggtgccgtgtatgtgtacatgaac
cagggtggccattgggcagatatctctcctctccgactctgtggctcccctgactccatg
tttgggatcagtttggctgtactgggggacctcaatcaagatggctttccagacattgct
gtaggagctccctttgacggagatgggaaagtctttatctaccatgggagcagcctgggg
gtggtcaccaaaccttcacaggtgctggagggtgaggctgtgggtatcaagagctttggt
tactccctgtctggtggcctggatgtggacggaaatcactacccggacctgcttgtgggc
tccctggctgatactgctgctctgttcagggccagacctgttctacatgtctcccaagaa
atcttcattgatccaagagccatcgatctggaacagcccaactgtgccgacggacgcttg
gtctgcgtgcacgtaaaggtctgtttcagttatgttgctgtgcccagcagctacagccct
attgtggtcctagattatgtgttagatggggacacagaccggaggctccggggccaggct
ccacgtgtgactttcccgggccgaggcccggatgatctcaagcatcagtcctcgggcacc
gtgtcgttgaagcaccaacatgacagagtctgtggagacactgtgttccagctgcaggaa
aacgtcaaagacaagctacgggccattgtggtgaccctgtcatatggtctccaaacccct
cgattaaggaggcaagcgcctgaccaggggctcccccttgtggctcccatcctcaacgct
caccagcccagtacacagaggactgagatccacttcctgaagcaaggctgtggtgacgat
aagatctgtcagagcaacctccagcttgcgcaggcccagttctgttcccggatcagcgac
acagagttccaggctctgcccatggatctggatgggaccgccctgtttgcgctgagcggg
cagccattcataggcctggagctgacagtcaccaacctgccctctgacccagcccggcct
caggcagatggggatgatgctcatgaagcccagctcctggccaccctcccagcctctctt
cgatactcgggagtccgcactctggactctgtggagaagccgctctgcctgtccaacgag
aatgcctctcatgtcgagtgtgagctcgggaaccctatgaagagaggcactcaggtcacc
ttctacctcatcctcagcacctctggaatcaccattgagaccacagagctgaaggtggaa
ttgctcttagccacgatcagtgagcaggacctgcatccggtctccgttcgggctcatgtc
ttcattgaattgccgctgtccatttcaggggtggccactcctcagcaactcttcttctct
ggcaaggtgaagggggagagcgccatgcggtctgagagggacgtgggcagcaaggtcaag
tacgaggtcacggtctccaatcaaggccagtcactcaatactctgggctctgccttcctc
aacatcatgtggccccatgagatcgccaatgggaaatggctgttgtaccccatgcgggtg
gagctggagggtggacaggggcctgagaagaaagggatctgctccccaagacccaacatc
ctccacctggatgtggacagcagggataggaggcggcgagagctggggcagccggagcct
caggagcctccagagaaggtggaacctagcacatcttggtggccagtgtcctccgctgag
aagagaaacgtgactctggactgtgcccagggcacggccaagtgtgtggtattcagctgc
ccactctacagctttgaccgtgcagccgtgcttcatgtctggggccgcctctggaacagc
acctttctggaggagtacatgtccgtgaagtccctggaggtgatcgtccgagccaacatc
acagtgaaatcctccattaagaacttgctgctcagagatgcatccacagtgatcccagtg
atggtatacttggacccggtggctgtggttgcagaaggagtcccctggtgggtcatcctc
ctggcggtgctggctgggctgctagtactggccctgctggtgctgctgctgtggaagctg
ggattcttcaagcgggcgaagcaccctgaggccactgtaccccagtaccacgcagtgaag
atccttcgggaagaccggcagcagttcaaggaggagaagacaggcaccattcagaggagt
aactggggcaattcccagtgggagggctccgacgcacaccctatcctggctgccgactgg
caccctgagttgggtcctgatggacatcctgtgtcagtcactgcctaa

DBGET integrated database retrieval system