KEGG   Rattus norvegicus (rat): 114517
Entry
114517            CDS       T01003                                 

Gene name
Itga6
Definition
(RefSeq) integrin alpha-6 precursor
  KO
K06485  integrin alpha 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04514  Cell adhesion molecules
rno04640  Hematopoietic cell lineage
rno04810  Regulation of actin cytoskeleton
rno05145  Toxoplasmosis
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05222  Small cell lung cancer
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    114517 (Itga6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    114517 (Itga6)
   04514 Cell adhesion molecules
    114517 (Itga6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114517 (Itga6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114517 (Itga6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    114517 (Itga6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114517 (Itga6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    114517 (Itga6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    114517 (Itga6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    114517 (Itga6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    114517 (Itga6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    114517 (Itga6)
   05414 Dilated cardiomyopathy
    114517 (Itga6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    114517 (Itga6)
   04515 Cell adhesion molecules [BR:rno04515]
    114517 (Itga6)
   04090 CD molecules [BR:rno04090]
    114517 (Itga6)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   114517 (Itga6)
  Exosomal proteins of breast milk
   114517 (Itga6)
Cell adhesion molecules [BR:rno04515]
 Integrins
  Integrin alpha subunits
   114517 (Itga6)
CD molecules [BR:rno04090]
 Proteins
  114517 (Itga6)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP FG-GAP_3 Integrin_alpha PAG
Other DBs
NCBI-GeneID: 114517
NCBI-ProteinID: NP_446177
RGD: 621633
Ensembl: ENSRNOG00000001518
UniProt: Q924W2 Q924W3
Position
3
AA seq 1073 aa
MAVAGQLCLLYLSAGLLARLSTAFNLDTREDNVIRKSGDPGSLFGFSLAMHWQLQPEDKR
LLLVGAPRAEALPLQKANRTGGLYSCDITSRGPCTRIVFDNDADPMSESKEDQWMGVTVQ
SQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNTFFDMNIFEDGPYEVG
GETDHDESLVPVPANSYLGFSLDSGKGIVSKDDITFVSGAPRANHSGAVVLLKRDMKSAH
LLLEYIFDGEGLASSFGYDVAVVDLNADGWQDIVIGAPQYFDRDGEVGGAVYVYINQQGR
WSNVKPVRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPYDDLGKVFIYHGSPTGIITK
PTQVLEGTTPFFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINILKTITVTPSR
IDLRQKSMCGSPSGICLKVKACFEYTAKPSGYNPPISILGILEAEKERRKSGLSSRVQFR
NQGSEPKYTQELTLNRQKQRACMEETLWLQENIRDKLRPIPITASVEIQEPSSRRRVNSL
PEVLPILNSNEAKTVQTDVHFLKEGCGDDNVCNSNLKLEYKFGTREGNQDKFSYLPIQKG
IPELVLKDQKDIALEITVTNGPSDPRNPRKDGDDAHEAKLIATFPDTLTYSAYRELRAFP
EKQLSCVANQNGSQADCELGNPFKRNSSVTFYLILSTTEVTFDTTDLDINLKLETTSNQD
NLAPITAKAKVVIELLLSVSGVAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEFRVINLG
KPLKNLGTATLNIQWPKEISNGKWLLYLMKVESKGLEQVVCEPHNEINFLKLKESHNSRK
KRELPEKQIDDSRKFSLFSERKYQTLNCSVNVRCVNIRCPLRGLDSKASLVLRSRLWNST
FLEEYSKLNYLDILVRASIDVTAAAQNIKLPHAGTQVRVTVFPSKTVAQYSGIAWWIILL
AVLAGILMLALLVFLLWKCGFFKRNKKDHYDATYHKAEIHTQPSDKERLTSDA
NT seq 3222 nt   +upstreamnt  +downstreamnt
atggcggtcgccggccagttgtgcttgctctacctgtccgcagggcttctggcccggctg
agcacagctttcaacctggatacccgcgaggacaacgtgatccggaaatcgggggatccc
gggagcctcttcggcttctcgctcgccatgcactggcagttgcagccggaggacaagcgg
ctgttgcttgtgggggcacctcgggcagaagcacttcccctgcagaaggcgaacagaaca
gggggcctgtacagctgtgacatcacctcccggggaccttgcacacgaattgtatttgat
aatgatgctgatcctatgtcagaaagcaaggaagaccagtggatgggagtcactgtccag
agtcaaggtccagggggcaaagtggtgacgtgtgcgcatcgatacgagaaacggcagcac
gttaacacgaagcaggagtcccgggacatcttcggaaggtgttacgtcctgagtcagaat
ctcagaattgaagatgatatggatggaggagactggagtttctgtgatggccgattgagg
ggccatgaaaaatttggctcttgtcagcaaggagtagcggctactttcactaaagacttt
cattacattgtttttggagccccagggacttacaactggaaagggatcgttcgtgtagaa
caaaagaataacactttttttgacatgaacatctttgaagatgggccctatgaagttggt
ggagagactgatcatgacgaaagtctcgtgcccgttcctgctaacagttatctaggcttt
tctctggactcagggaagggtattgtttctaaagatgacatcacttttgtatctggtgct
ccaagagccaatcacagtggggctgtagttttgctaaaaagagacatgaagtcagcacat
cttctccttgagtatatatttgatggtgaaggcctggcttcttcgtttggctatgacgtg
gcggtggtggacctcaatgcagatgggtggcaagacatcgttatcggagcgccacagtac
tttgacagggatggcgaagtcgggggtgcggtgtacgtctacattaaccagcaaggcaga
tggagtaatgtgaagccagttcgtctaaatgggaccaaagactcgatgtttggaatcgca
gtgaaaaatatcggcgatattaatcaagatggctatccggatattgctgttggagctccc
tatgacgatctggggaaggtttttatctatcatggatccccgactggcataattaccaag
ccaacacaggttcttgagggtacaacgcctttcttcggctactcaatcgctgggaacatg
gacctggacaggaattcctaccctgacgttgctgtgggttccctctcagactcagtaact
attttcagatcccggccagtgattaacattctgaaaaccatcacagtgactcctagcaga
attgacctccgccagaaatccatgtgtgggtcacctagcgggatatgcctcaaggttaaa
gcctgttttgaatatactgcgaagccctccggttataaccctccaatatcaattttgggt
attcttgaagctgaaaaagaaagaagaaagtcagggttgtcgtcaagagttcagtttcga
aaccaaggttctgagccaaagtatactcaggagctgaccctgaacaggcagaagcagcgg
gcatgcatggaggagacgctctggctgcaggaaaacatcagagacaagctgcgccccatc
cccatcacggcttctgtggagatccaggagcccagctctcgacggcgggtgaattcactt
ccagaagttcttcccatcttgaattcaaatgaagccaaaacagtgcagacagatgtccac
ttcttaaaggaaggatgtggagacgacaatgtctgtaacagcaaccttaagctagagtat
aaatttggtacccgagaaggaaatcaagacaaattctcttaccttccaattcagaaaggc
atcccagaattagtcctaaaagatcagaaagatatagctctggaaataacggtgaccaac
ggcccttctgatccaaggaatccccggaaagatggtgacgatgcccacgaagccaaactc
atcgcaacgtttccagacaccctgacatattccgcctacagagagctgagggctttccct
gagaagcagctgagctgtgttgccaaccagaatggctcccaagctgactgtgagctcgga
aatcctttcaagagaaattccagtgttactttttatctgattttaagtaccaccgaggtc
acctttgacaccacagatctggatattaatctgaagttggaaacaacaagcaatcaggat
aatttggctccaattacagcgaaagcaaaagtggttattgaattgcttttatcggtctct
ggagtcgctaagccttcgcaggtgtattttggaggtacagttgttggtgagcaggccatg
aagtctgaagatgaagtaggaagtttaatagagtatgaattcagggtgattaacttgggt
aaacctcttaaaaacctcggcacggcaaccctgaatatccagtggcccaaggagattagc
aatggcaaatggttgctttatttgatgaaggtcgaatccaaaggtttggagcaggttgtc
tgtgagccacacaatgaaataaacttcctcaagctgaaggagtctcacaactcaagaaag
aagcgggaacttcctgaaaaacagatagacgacagcaggaagttttctctattttccgaa
agaaaataccagaccctcaactgcagcgtcaacgtgaggtgtgtgaacatcaggtgtcca
ctgcgagggctggacagcaaggcctctctcgttctacgctccaggctgtggaacagcacg
tttctagaggaatattccaaactgaactacttggacatcctcgtgagggcgtccatagat
gtgaccgccgccgctcagaatatcaagctccctcatgcgggcactcaggttcgagtgacg
gtgtttccctcaaagacggtagctcagtattcagggatagcgtggtggatcatcctcctg
gctgtgcttgccgggattttgatgctggctctattagtgtttttactgtggaagtgtggt
ttcttcaagagaaataagaaagatcattacgatgccacctaccacaaggctgagatccac
actcagccgtctgataaagagaggcttacttccgatgcatag

KEGG   Rattus norvegicus (rat): 170921
Entry
170921            CDS       T01003                                 

Gene name
Itga2
Definition
(RefSeq) integrin alpha-2
  KO
K06481  integrin alpha 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04611  Platelet activation
rno04640  Hematopoietic cell lineage
rno04810  Regulation of actin cytoskeleton
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05222  Small cell lung cancer
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    170921 (Itga2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    170921 (Itga2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    170921 (Itga2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    170921 (Itga2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    170921 (Itga2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    170921 (Itga2)
   04611 Platelet activation
    170921 (Itga2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    170921 (Itga2)
   05205 Proteoglycans in cancer
    170921 (Itga2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    170921 (Itga2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    170921 (Itga2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    170921 (Itga2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    170921 (Itga2)
   05414 Dilated cardiomyopathy
    170921 (Itga2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    170921 (Itga2)
   04515 Cell adhesion molecules [BR:rno04515]
    170921 (Itga2)
   04090 CD molecules [BR:rno04090]
    170921 (Itga2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   170921 (Itga2)
  Exosomal proteins of bladder cancer cells
   170921 (Itga2)
Cell adhesion molecules [BR:rno04515]
 Integrins
  Integrin alpha subunits
   170921 (Itga2)
CD molecules [BR:rno04090]
 Proteins
  170921 (Itga2)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_2 FG-GAP_3 Integrin_alpha DUF11 HisK_sensor
Other DBs
NCBI-GeneID: 170921
NCBI-ProteinID: XP_345157
RGD: 621632
Ensembl: ENSRNOG00000058111
UniProt: A0A0G2K470
Position
2
AA seq 1178 aa
MGPGQAGGALLLQLLLLTQGLLSCLAYNVGLPGAKIFSGSSSEQFGYSVQQLTTPQGNWL
LVGSPWSGFPDNRMGDVYKCPVDLPTATCEKLNLQNSASISNVTEIKTNMSLGLTLTRNP
GTGGFLTCGPLWAHQCGNQYYATGICSDVSPDFQSLTSFSPAVQACPSLVDVVVVCDESN
SIYPWEAVKNFLEKFVQGLDIGPKKTQVALIQYANDPRVVFNLTTYKNKEDMVQATSETR
QYGGDLTNTFKAIQFARDIAYLPESGGRPGATKVMVVVTDGESHDGSKLQTVIQQCNDDE
ILRFGIAVLGYLNRNALDTKNLIKEIKAIASTPTERYFFNVADEAALLEKAGTLGEHIFS
IEGTVQGGDNFQMEMAQVGFSADYSPQNDILMLGAVGAFDWSGTVVQETSYEHLIFPKQA
FDQVLQDRNHSSFLGYSVAAISTENGVHFVAGAPRANYTGQIVLYSVNKHGNVTVIQSHR
GDQIGSYFGSVLCSVDVDKDTITDVLLVGAPMYMNDLKKEEGKVYLFTITKGVLNQHQFL
EGPEGTGNARFGSAIAALSDINMDGFNDVIVGSPVENENSGAVYIYNGHQGTIRTKYSQK
ILGSDGAFKSHLQFFGRSLDGYGDLNGDSITDVSIGALGQVVQLWSQSVADVATEASFTP
DKIILLNKEAKITLKLCFRAKFRPPGQNHQVAILFNMTLDADQYSSRVTSRGIFRENSER
FLQKTMVVSEVENCSEYHISIQKPSDVVNPLDLRVDISLEKPGTSPALEAYSETVKVFSI
PFYKECGSDGICISDLILDVRQLPALRNQPFIVSNQNKRLTFSVTLKNRGESAYNTAVLA
EFSENLFFASFSMPVDGTEVTCQIGSSQKSVTCDVGYPALKSEQQVTFTINFDFNLQNLQ
NQAAINFQAFSESQETNKADNSVSLIVPLLYDAELHLTRSTNINFYEISSDENAPSVINS
VEDIGPEFIFSLKITAGSAPVSMASVTIHIPLHTKEKNPLLYLTGIQTDKAGDISCRAEI
NPLNLPHTASPVSFKSENFRHMKELDCKTTSCSNVSCWLKDLHMKAEYFINVTTRVWNRT
FAASTFQTVQLTAAAEIDTHNPQLFVIEENAVTIPLMIMKPTEKAEVPTGVIIGSIIAGI
LLLLAMVAGLWKLGFFKRQYKKMGQNPDETDETTELNS
NT seq 3537 nt   +upstreamnt  +downstreamnt
atgggaccgggacaggcagggggcgcgcttctgctgcagctgctactgctcactcaaggt
cttttgagttgtctggcatataatgttggcctcccaggagcgaaaatattttctgggtct
tcaagtgaacagtttggctattcggtgcagcagcttacgaccccacaaggcaactggcta
ctggttggttcgccatggagtggcttccctgacaaccgaatgggagacgtgtacaagtgc
cctgttgacttacccactgccacctgtgaaaagctgaatctgcaaaattcagcaagcatc
tcaaatgttaccgagataaagaccaacatgagcctgggtttgaccctcaccaggaatccg
gggaccggcggctttctaacctgcggtcctctgtgggcacatcagtgtggaaatcagtat
tatgcaactggaatttgttctgatgtcagtccagactttcagtcgttgacaagcttctca
cctgcagttcaagcttgcccttccctcgtagatgtcgtagttgtctgtgatgaatcaaac
agtatttatccctgggaagcagtaaagaattttttggaaaagtttgtgcaaggcctggat
ataggacctaaaaagacacaggtggcgttaattcaatatgccaacgacccaagagttgtc
tttaacttgaccacttacaaaaacaaagaagatatggttcaggccacatccgagacgcgc
cagtatggtggggacctcacaaacaccttcaaggctatccaatttgcaagagacattgct
tatttaccggagtctggcgggcgcccaggtgctacaaaagtcatggtagttgtgactgat
ggggaatcccatgatgggtcgaagctgcaaactgtgatccagcaatgcaatgatgacgag
atactgaggtttggcatagcggttcttggatatttaaacagaaatgctcttgatactaaa
aatctaatcaaagaaattaaagcaatcgctagcactccaacggagaggtactttttcaat
gtggccgatgaggcggctcttctggagaaagctggcactctaggggagcacatattcagc
attgaaggcactgttcaaggaggagacaacttccagatggaaatggcacaagttggattc
agtgcagattactctcctcaaaatgatatcctgatgctaggtgcagtgggagcttttgac
tggagtggaactgttgtccaggagacatcttacgagcacttgatctttcctaaacaagcc
tttgaccaggttctgcaggatagaaatcacagttcatttttaggttactctgtggctgca
atttctactgaaaatggtgtccactttgttgctggtgctcctcgagcaaattatactggc
cagatagtgctgtacagtgttaacaagcatggcaatgtgaccgtgattcagtctcacaga
ggggaccagattggctcctattttggcagtgtgctgtgttcggtggatgtggataaagat
accattacagatgtgctcttggtaggtgctcccatgtacatgaacgacctcaagaaagaa
gaagggaaagtctacctgttcacaatcacaaagggcgtcctgaaccagcaccagtttctt
gaaggacctgaaggcactggaaatgctcggtttggttcagcaattgcagccctttcagac
atcaacatggatggctttaatgatgtgattgttggttcgcctgtagagaatgagaactct
ggagctgtgtacatctacaatggccaccagggtaccattcgcaccaagtactcccagaaa
atccttggatccgacggagcctttaagagccatctccagttctttggaaggtccctggat
ggctatggagatttaaatggggactccatcactgatgtatccattggtgctttggggcaa
gtggttcaactctggtcacaaagcgttgcagatgtggccacagaagcttcgttcactcca
gacaaaatcatattgctcaacaaggaagctaagataaccctcaaactctgcttcagagca
aagtttagacctcctgggcaaaaccaccaagtggccatcctgtttaacatgacacttgat
gctgaccaatattcatccagagtaacctccagggggatatttagagaaaatagtgagcga
ttcttgcagaagactatggttgtaagtgaagtggagaactgttctgagtaccacattagt
atacagaagccctctgatgttgtcaaccctttggatctgcgagtggacatcagtttggaa
aagccaggcactagccctgcccttgaagcctattcagaaactgtgaaagtcttcagtatc
cctttctataaagagtgtggcagcgatggaatttgcatctctgacctgatcctggatgtc
cgacagctgccagcccttagaaatcagccctttattgtcagtaaccaaaacaagaggtta
acattttcagtcacactgaaaaacagaggggaaagcgcgtacaacactgccgtcctggct
gagttttctgagaacttgttttttgcctctttctccatgccggtcgatggaacagaagta
acatgccagattggttcatcacagaaatctgttacctgtgacgtgggataccctgcctta
aagagtgagcagcaggtgacttttaccattaacttcgacttcaatcttcagaacctccag
aatcaggcggccatcaatttccaagccttcagtgagagccaagaaacaaacaaagcagac
aattcggtcagcctcatagttcctctcctgtatgacgctgaacttcacttaaccagatcc
accaacataaacttttatgaaatctcttcggatgagaatgctccttctgtcataaacagt
gttgaagatattggtcctgaattcatcttctctctcaagataacagcgggaagtgctcca
gtgagcatggcatcagtaaccatccacattcctctgcacaccaaggaaaagaacccactc
ctgtatctgaccgggatacaaacagacaaggctggcgacatcagctgcagagcagaaatt
aatccactaaacttaccacacacggcctcacccgtatctttcaagagtgaaaacttccgg
catatgaaagaattggactgcaaaaccacttcctgcagtaacgtctcctgctggctgaaa
gaccttcacatgaaagcggagtactttatcaatgtgactaccagggtttggaacaggacc
tttgctgcatcaactttccagactgtgcagctgacagcagcagccgagatcgatacgcat
aaccctcagctcttcgtgattgaagaaaatgctgtcacgattcccctcatgataatgaaa
cccaccgagaaagcagaagtgcccacaggagttatcataggaagcataattgctggaatc
cttttgctgttggctatggttgcaggcttgtggaagctcggcttcttcaaaagacaatat
aaaaaaatgggccaaaatccagatgagacggacgagaccacagaactcaacagctaa

KEGG   Rattus norvegicus (rat): 296456
Entry
296456            CDS       T01003                                 

Gene name
Itgav
Definition
(RefSeq) integrin alpha-V isoform X1
  KO
K06487  integrin alpha V
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04514  Cell adhesion molecules
rno04810  Regulation of actin cytoskeleton
rno04919  Thyroid hormone signaling pathway
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05222  Small cell lung cancer
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    296456 (Itgav)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    296456 (Itgav)
   04514 Cell adhesion molecules
    296456 (Itgav)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    296456 (Itgav)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    296456 (Itgav)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    296456 (Itgav)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    296456 (Itgav)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    296456 (Itgav)
   05205 Proteoglycans in cancer
    296456 (Itgav)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    296456 (Itgav)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    296456 (Itgav)
   05165 Human papillomavirus infection
    296456 (Itgav)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    296456 (Itgav)
   05410 Hypertrophic cardiomyopathy
    296456 (Itgav)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    296456 (Itgav)
   05414 Dilated cardiomyopathy
    296456 (Itgav)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    296456 (Itgav)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    296456 (Itgav)
   04515 Cell adhesion molecules [BR:rno04515]
    296456 (Itgav)
   04090 CD molecules [BR:rno04090]
    296456 (Itgav)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    296456 (Itgav)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   296456 (Itgav)
  Exosomal proteins of epithelial cells
   296456 (Itgav)
Cell adhesion molecules [BR:rno04515]
 Integrins
  Integrin alpha subunits
   296456 (Itgav)
CD molecules [BR:rno04090]
 Proteins
  296456 (Itgav)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP FG-GAP_3 Integrin_alpha LYRIC DctQ Collectrin
Other DBs
NCBI-GeneID: 296456
NCBI-ProteinID: XP_038962373
RGD: 1310613
Ensembl: ENSRNOG00000004912
Position
3
AA seq 1043 aa
MADPGRLLLRPRPGGLLLLLLGLLLPFAGSFNLDVESPAEYAGPEGSYFGFAVDFFVPST
SSRMFLLVGAPKANTTQPGIIEGGQVLKCDCSSSRRCQPIEFDSTGNRDYAKDDPLEFKS
HQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSKNIDAD
GQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIISKYDPNVYSIKYNNQLAT
RTAQAIFDDSYLGYSVAVGDFNGDGIEDFVSGVPRAARTLGMVYIYDGKNMSSLHNFTGE
QMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTK
LNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGLVYIFNGRSTGLNSVPSQI
LQGQWAAQSMPPSFGYSMKGATDVDRNGYPDLVVGAFGVDRAVLYRARPVVTVNAGLEVY
PSILNQDNKICPLPGTALKVSCFNVRFCLKADGKGTLPRKLNFQVELLLDKLKQKGAIRR
ALFLHNRSPGHSKDMTVFRGGQTQCEELVAYLRDESEFRDKLTPITIFMEYRLDQRTAAD
ATGLQPILNQFTPANVSRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLTVK
AQNQGEGAYEAELIVSIPPQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAG
TQLLAGLRFSVHQQSEMDTSVKFDLKIQSSNSFDNVSPVVSYKVDLAVLAAVEIRGVSSP
DHIFLPIPNWEYKETPETEEDVGPVVQHIYELRNNGPSSFSKAILNLQWPYKYNNNTLLY
ILHYDIDGPMNCTADTEINPLRIKTPEKNDTAAEQGGRNHLITKRDLSLSEGDVHTLGCG
TAQCLQITCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNIIEFPYKN
LPIEDLFNSTLVTTNITWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVR
PPQEEQEREQLQPHENGEGNSET
NT seq 3132 nt   +upstreamnt  +downstreamnt
atggctgatcccgggcggctgctgctacgccctcgccccggtggcctcctgctcctgctg
ctcggcctcctactgcccttcgccggctccttcaacctggacgtcgaaagccccgccgag
tacgccggccccgagggaagttacttcggattcgccgtggacttcttcgtgcccagcacg
tcctccaggatgttcctcctggtgggagccccaaaagcaaacacaacccagcctgggatt
atagaaggagggcaagttctcaaatgtgactgctcatccagccgccggtgccagcccatt
gaatttgattcaacaggcaatcgagattatgccaaagatgacccactggagtttaaatcc
caccagtggtttggagcctccgtgaggtcaaagcaggataaaatcttggcctgtgctcca
ttgtaccactggaggactgagatgaagcaggagagagagccagttggaacctgctttctt
caggatggcacaaagaccgttgagtatgctccatgcaggtcaaaaaatattgatgctgat
ggacagggattttgtcaaggaggattcagcattgattttactaaagccgacagagtactt
cttggaggtcccggcagcttttattggcagggtcagctcatttcagatcaagtggcagaa
atcatatctaaatatgacccaaatgtctacagcatcaaatataataaccaactagccaca
cggactgcacaagcaatttttgatgacagttatttgggttactctgtggccgtgggagac
ttcaatggtgacggcattgaagattttgtttctggagttccaagagcagcaaggactttg
ggaatggtttatatttatgatgggaaaaacatgtcttcattacacaattttactggtgaa
cagatggctgcatattttggattttctgtagctgctactgacattaatggggatgattat
gcagatgtgtttattggagcccctctgttcatggaccgaggttctgatggaaaactccag
gaggtcggccaggtctcagtgtctctacagagagcgtcgggagacttccagactacaaag
ctgaacgggtttgaggtttttgccagatttggaagtgccatagctcctttgggagacctg
gaccaggatggcttcaatgacattgcaattgctgctccatatggtggcgaagataaaaag
ggacttgtttatatcttcaatggaagatccacaggcttgaattcggtgccatctcaaatc
ctgcaggggcagtgggccgctcagagcatgcccccaagctttggctattcaatgaaggga
gctacagatgtagatagaaatggatatccagacttagttgtcggagcttttggtgtggac
cgagctgtcttatacagagccagacctgttgtcaccgtaaatgctggccttgaagtgtac
cctagcattttaaatcaagacaataaaatctgcccattgcctgggacagctctcaaggtt
tcctgttttaatgtcaggttctgcttaaaggcggatggcaaagggacacttccgaggaaa
ctcaacttccaggtggagcttcttttggataaactcaagcagaagggagccatccggcga
gcactgtttctccataacaggtccccggggcactctaaggacatgactgttttcaggggg
ggacagacgcagtgtgaggaactggtcgcctatcttcgggatgaatctgagtttagagac
aagctcactcccatcactatttttatggagtatcggctggaccagagaacggctgctgat
gccacaggcttgcagcccatcctgaaccagttcactccggccaacgtcagtcggcaggct
cacattttacttgactgtggcgaagacaatgtctgtaaacctaaactggaagtttctgta
gatagtgatcaaaagaagatctatattggggatgacaaccctctgaccctgaccgtgaag
gcgcagaatcaaggagaaggcgcctatgaagctgagctcatcgtttctatcccaccacag
gctgacttcatcggggttgtccggaacaacgaagccttagcaagactgtcctgtgcattt
aagacagaaaaccaaacccggcaggtggtgtgtgaccttgggaacccgatgaaggctgga
actcaactgcttgctggccttcgtttcagcgtgcaccagcaatcagagatggatacttct
gtgaagtttgacttgaaaatccaaagctctaattcttttgacaatgtcagcccagtcgtg
tcttacaaggtcgaccttgccgttttggctgccgttgagataagaggagtttcaagccca
gatcacatctttcttccaattccaaactgggagtacaaggaaacccctgagactgaagaa
gacgttgggcctgttgttcagcacatctatgagctgagaaacaatggtccaagttcattc
agcaaggcaatcctgaacctccagtggccttacaaatacaacaacaatactttgctgtac
attctccattacgacattgatgggccgatgaactgtactgccgacacagagatcaaccct
ctgagaattaagacgcccgaaaagaatgacacagcagctgagcaaggaggaagaaatcat
ctcatcaccaagcgggatctcagcctcagtgagggagatgttcacactttgggctgtgga
actgctcagtgcttgcagatcacctgccaggtcggtcgactggatagagggaagagcgcc
atcctgtacgtgaaatccctgctgtggaccgagacgtttatgaacaaggagaaccagaac
cattcctattccctgaagtcatccgcttcatttaatatcatagaattcccttacaagaat
cttccgattgaggatctcttcaactctacgctagtcaccacgaacatcacctggggcatt
cagccagcacccatgcctgtgcctgtgtgggtgatcatcttggcggttctcgcagggctg
ctgttactggccgtgttggtatttgtaatgtacaggatgggctttttcaaacgtgtccga
ccacctcaagaagagcaagaaagagaacagcttcagcctcatgagaacggcgaaggaaac
tctgaaacctaa

KEGG   Rattus norvegicus (rat): 360606
Entry
360606            CDS       T01003                                 

Gene name
Itga3
Definition
(RefSeq) Integrin alpha-3 isoform 1
  KO
K06482  integrin alpha 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04640  Hematopoietic cell lineage
rno04810  Regulation of actin cytoskeleton
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05222  Small cell lung cancer
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    360606 (Itga3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    360606 (Itga3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    360606 (Itga3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    360606 (Itga3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    360606 (Itga3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    360606 (Itga3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    360606 (Itga3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    360606 (Itga3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    360606 (Itga3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    360606 (Itga3)
   05414 Dilated cardiomyopathy
    360606 (Itga3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    360606 (Itga3)
   04515 Cell adhesion molecules [BR:rno04515]
    360606 (Itga3)
   04090 CD molecules [BR:rno04090]
    360606 (Itga3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   360606 (Itga3)
Cell adhesion molecules [BR:rno04515]
 Integrins
  Integrin alpha subunits
   360606 (Itga3)
CD molecules [BR:rno04090]
 Proteins
  360606 (Itga3)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP FG-GAP_3 FG-GAP_2 MTABC_N
Other DBs
NCBI-GeneID: 360606
NCBI-ProteinID: NP_001101762
RGD: 1310333
Ensembl: ENSRNOG00000004276
Position
10
AA seq 1052 aa
MGPGPRRVPRDPGWMLRALALMVAASGRVAFAFNLDTKFLVVKEAVNPGSLFGYSVALHR
QTERQQRYLLLAGAPRDLAVDDDYTNRTGAVYLCPLTALKNDCERMDISEKSDPDHHIIE
DMWLGVTVASQGPAGRVLVCAHRYTKVLWSGLEDQRRMVGKCYVRGNDLQLDPGDDWQTY
HNEMCNSNTDYLQTGMCQLGTSGGFTQNTVYFGAPGAYNWKGNSYMIQRKDWDLSEYSYR
GSEDQGNLYIGYTMQVGSAILHPSEITLVTGAPRHQHMGAVFLLKQESGGDLQRRQVLKG
TQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAVYVFMNQAGTSFPDQPSLL
LHGPSRSAFGISVASIGDINQDGFQDIAVGAPFEGLGKVYIYHSSSGGLLKQPQQIIHGE
TLGLPGLATFGYSLSGKMDVDENLYPDLLVGSLSDHIVLLRARPVINILHRTLVARPAVL
DPSLCTVTSCVQVELCFAYNQSAGNPNYRRNITLAYTVEADRDRRPPRLRFARSQSSVFH
GFFSMPETHCQTLELLLMDNVRDKLRPIVITMNYSLPLRMPDRLKLGLRSLDAYPVLNQA
QAMENHTEVHFQKECGPDNKCDSNLQMRAAFVSEQLQPLSRLQYSRDTKKLFLSINVTNS
PSRQRAGEDAHEALLTLEVSSALLLSSVRPAGTCQANETNTVCELGNPFKRNQRMELLIA
FEVTGVTLHTRDLRAHLQLSTSSHQDNLQPMFLTLQVDYTLQASLSLMNHRLQSFFSGTV
MGEAAMKTVKDVGSPLKYEFQVSPVGDGLAALGTLVLGLEWPYEVTNGKWLLYPTEITIH
SNGSWPCQPHGNLVNPLNLTLSDPGVKPLSPQRRRRQLDPGGDQGPPPVTLAAAKKAKSE
TVLTCSNGRARCVWLECPLPDASNITNVTVKARVWNSTFIEDYKDFDRVRVDGWATLFLR
TSIPTINMENKTTWFSVDIDSELVEELPAEIELWLVLVAVGAGLLLLGLIIILLWKCGFF
KRARTRALYEAKRQKAEMRSQPSETERLTDDY
NT seq 3159 nt   +upstreamnt  +downstreamnt
atgggccctggcccgcgccgcgtgccccgcgaccctggctggatgctccgcgccctggct
ttgatggtggcggctagtggccgggtcgccttcgctttcaacctggacaccaaattcctg
gtggtgaaggaggcggtgaaccctggtagcctctttggctactccgtcgccctccatcgg
cagactgagcgacagcagcgctacctccttctggccggtgcaccccgagacctcgcagtg
gatgatgactacaccaaccggactggtgctgtgtacctgtgtcccctcactgccctcaag
aacgattgtgaacgcatggacatttcagagaagagtgaccctgaccatcacattattgag
gacatgtggcttggagtgactgtggccagccagggccctgcaggtagagtcctggtctgt
gcccatcggtacaccaaggtgctgtggtctgggctggaagaccagcggcgcatggtgggc
aagtgctacgtgcgtggcaacgacctacagctcgaccctggcgatgattggcagacatac
cacaacgagatgtgtaacagcaacactgactacttgcagactggcatgtgccagctgggc
accagtggcggcttcacccagaacactgtatacttcggcgcccctggtgcctacaactgg
aaaggaaacagctacatgattcagcggaaagactgggatttatctgaatacagctacagg
ggctcagaggaccagggaaacctctatattgggtacacgatgcaggtaggcagtgccatc
ctacatccctcggagatcactcttgtgacgggtgccccacggcaccaacatatgggcgct
gtcttcttgctgaaacaagagtcgggtggagacctgcagaggaggcaggtgctgaagggc
acgcaggtgggcgcttattttggcagtgccattgccctggcagacctgaacaatgatggg
tggcaggacctcctggtgggtgctccctactacttcgaacggaaagaggaggtagggggt
gccgtctatgtcttcatgaaccaggcgggaacgtccttccctgatcagccttccctcctg
ctccatggccccagtcgctctgcctttggcatctctgtagccagcattggtgacatcaac
caggatggattccaggacattgctgtgggagctccatttgagggcttgggcaaagtatac
atctaccacagcagctccggggggctcctcaagcagcctcagcagataatccacggagag
acactaggactgcctggcttggccaccttcggctactctctgagtgggaagatggatgtg
gatgaaaacttatacccagacctgctagtagggagcctgtcggaccacattgtgctgctg
cgggcccgacctgtcatcaatatcctccacaggaccttggtggccaggccagctgtgttg
gacccctcgctttgtacggttacttcctgtgttcaggtggagctgtgctttgcctacaac
cagagtgccgggaaccccaactacaggcggaacatcaccctggcttacacagtggaggct
gacagggaccgacgcccacccaggctccgattcgcccgtagccagtcgtcggtcttccat
ggcttcttctccatgccagagacacattgccagacattggagttactgctgatggacaat
gttcgtgataaactccgtcctatcgtcatcaccatgaactactccttacctttgcgcatg
cccgatcgcctcaagctgggcttacggtccctggatgcctacccggtcctcaaccaggca
caggctatggagaatcacaccgaggtccacttccagaaagagtgcgggccagacaacaag
tgcgacagcaacctgcagatgcgagccgccttcgtgtctgagcagctgcagcctctaagc
aggctccagtacagcagagacactaagaaactgttcttgagcatcaatgtgaccaattcg
ccgagccgccaacgggctggggaagatgcccatgaggcactgctcactctagaggtgtca
tccgctctgcttctgtcctccgtgcgcccggctgggacctgccaagctaacgagaccaac
accgtgtgtgagctaggaaaccccttcaaacggaaccagaggatggagctgctcatcgcc
tttgaggtcaccggggtaactttgcacacgagggaccttagggcacatctacagctgtcc
acgtcaagtcaccaggacaacttgcagcccatgttcctgactttgcaggtggactacacc
ctccaggcctcgctcagtttgatgaatcatcgactgcagagcttctttagtgggacagtg
atgggcgaggctgccatgaagactgtgaaggatgtgggaagccccctgaaatatgaattc
caggtgagcccagtgggagacgggctggcagccttgggcacactggttctaggtctggag
tggccgtatgaagttaccaatggcaagtggctgctgtaccctacggagatcaccatccac
agcaatgggtcctggccctgccagccacatggaaaccttgtcaaccctctcaaccttact
ctctctgaccctggagtcaagccactgtccccacagcgccggcggagacaactagatcca
gggggagaccagggtcctccacctgtcacgctagctgctgccaaaaaagccaagtctgag
accgtgttgacctgttccaatggccgcgcccgctgtgtgtggctggagtgcccccttcca
gatgcctccaacattaccaatgtgaccgtgaaggcacgggtgtggaacagcaccttcatt
gaggactacaaagactttgacagagtccgagtagatggctgggctaccctgttcctgaga
accagtatccctaccatcaacatggagaataagaccacatggttctccgtggacatcgac
tctgagctggtggaggagctgcccgctgagatcgagctgtggttggtgcttgtggccgtg
ggtgctgggttgctgctactgggcctcatcatcatcctgctgtggaagtgcggcttcttc
aagcgagcccgcactcgtgccctgtatgaagctaagagacagaaggctgagatgaggagc
cagccatcagagacagaaaggctgaccgacgactactga

KEGG   Rattus norvegicus (rat): 685269
Entry
685269            CDS       T01003                                 

Gene name
Itga2b
Definition
(RefSeq) integrin alpha-IIb
  KO
K06476  integrin alpha 2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno04640  Hematopoietic cell lineage
rno04810  Regulation of actin cytoskeleton
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05222  Small cell lung cancer
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    685269 (Itga2b)
   04151 PI3K-Akt signaling pathway
    685269 (Itga2b)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    685269 (Itga2b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    685269 (Itga2b)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    685269 (Itga2b)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    685269 (Itga2b)
   04611 Platelet activation
    685269 (Itga2b)
   04613 Neutrophil extracellular trap formation
    685269 (Itga2b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    685269 (Itga2b)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    685269 (Itga2b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    685269 (Itga2b)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    685269 (Itga2b)
   05410 Hypertrophic cardiomyopathy
    685269 (Itga2b)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    685269 (Itga2b)
   05414 Dilated cardiomyopathy
    685269 (Itga2b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    685269 (Itga2b)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    685269 (Itga2b)
   04515 Cell adhesion molecules [BR:rno04515]
    685269 (Itga2b)
   04090 CD molecules [BR:rno04090]
    685269 (Itga2b)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     685269 (Itga2b)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   685269 (Itga2b)
Cell adhesion molecules [BR:rno04515]
 Integrins
  Integrin alpha subunits
   685269 (Itga2b)
CD molecules [BR:rno04090]
 Proteins
  685269 (Itga2b)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP FG-GAP_3 Integrin_alpha LYRIC
Other DBs
NCBI-GeneID: 685269
NCBI-ProteinID: XP_001063315
RGD: 1596428
Ensembl: ENSRNOG00000022071
Position
10
AA seq 1037 aa
MARASCAWNTLWLLQWTPLFLGPSAAPPAWALNLDSVKFSVYTGPNGSHFGFSVDFHKDS
HGSVSIVVGAPRALNANQEETGGVFLCPWKANNGTCTSLLFDLRDETRKLSLQTFQTFKT
GQGLGASVLSWNDVIVACAPWQHWNVLEKYDEAEKTPVGGCFVAELQSGGRAEYSPCRSN
TMSSVYSQGFSGDKRYCEAGFSLAVTQAGELVLGAPGGYFFLGLLVRVPIENIISSYRPG
TLLWHVSNQRFSYDSSNPVYFHGYRGYSVAVGEFDGDLSTTEYIFGAPTWSWTLGAVEIL
DSYYQTLHRLHGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRVDRKLAEVGRVYL
FLQPKGLQALSSPTLVLTGTQVYGRFGSAIAPLGDLNRDGYNDVAVAAPYGGPSGQGQVL
IFLGQSEGLSPRPSQVLDSPFPTGSGFGFSLRGSVDIDDNGYPDLIVGAYGASKVAVYRA
QPVVMATVQLMVQDSLNPTLKNCVLEQTKTPVSCFNVQMCVGATGHNIPQKLHLKAELQL
DLQKPRQARRVLLLASRQASLTLSLDLGGRNKPICHTIKAFLRDEADFRDKLSPIVLSLN
VSLPPEETGVAPAVVLHGVTHVQEQTRIILDCGEDNLCVPQLQLTATAGDSPLLIGADNV
LELKVNASNDGEGAYEAELAVHLPPGAHYIRAFSNVKGFERLVCTQKKENESRLALCELG
NPMKKDTRIGITMLVSVEILEEAGDSVSFQLQIRSKNSQNPNSEAVLLPVAVRAEAAVEL
RGNSFPASLVVAAEEVDKEQDGLDSWVSRVEHTYELHNNGPGTVNGLSLIIHLPGQSQPS
DLLYILDVQPKGGLLCSTQPPPKLLKVDRRLTTPSPSSIRRIHHDRDRREASPQGSKQTE
QQDPVLVSCNGSAPCTVVECELQEMVRGQRAMVTVQATLGLSILRQRPQEQFVLQSHAWF
NVSSLPYSVPVVSLPSGQGLVQTHLLRALEERDIPVWWVLVGVLGGLLLLTLLVLAMWKA
GFFKRNRPPLEEEEEEE
NT seq 3114 nt   +upstreamnt  +downstreamnt
atggccagagcttcatgtgcgtggaataccctgtggcttctgcagtggacaccactgttc
ctgggaccaagtgctgctcctcctgcctgggccttgaacctggactctgtgaagttctct
gtctatacaggccccaatggcagccactttggcttctcagtggactttcataaggacagc
catgggagcgtgtccatcgtggtgggcgcccccagggccctaaacgcaaatcaagaggag
actggaggtgtgttcctgtgcccctggaaggccaataacggcacatgtacctcgttgctt
ttcgacctcagggatgagacgcgaaaactaagcttgcaaactttccaaaccttcaagacc
gggcaaggacttggggcatcggtcctcagctggaatgacgtcattgtggcctgtgccccc
tggcagcactggaatgtcctagaaaagtacgatgaggcagagaagactccggtaggaggc
tgcttcgtggctgagctccaaagcgggggccgcgcagaatactcgccctgtcgctccaac
accatgagctccgtttactcacagggttttagcggagacaagcgatactgtgaagcaggc
ttcagcttggcggtgacccaggctggggagctagtgcttggggcccctggaggctacttt
tttttaggtctcctggttcgcgttccaattgagaatatcatctctagctaccgccccggt
acccttttgtggcatgtttccaaccagcgcttctcctacgactccagcaacccagtgtat
ttccacggttaccgggggtattcggtagctgtgggcgagttcgacggggatctaagcacc
acagagtatatattcggagcccccacttggagctggaccttgggagcggtggaaattttg
gactcctactaccagaccctgcacaggcttcatggagagcagatggcttcctatttcggg
cactcggtggcagtcactgacgtcaacggggatgggaggcatgacctactggtgggggct
ccattatacatggagagcagggtggaccgaaagctggccgaggtgggccgtgtatacttg
tttctgcagcctaagggtctccaggctctgagctcacccactctcgtgctgaccggcact
caggtgtatgggagatttggatctgccattgcacccctgggtgacctcaaccgagacggc
tataatgatgttgctgtggctgccccctatgggggtcccagtggtcagggccaagtgctg
atattccttggtcagagtgaagggctgagcccacgcccctcccaggtcctggacagtccc
ttcccgacaggctctggctttggcttctccctccgtggttctgtagacatcgatgacaat
ggatacccagacctgatcgtgggagcatatggggctagcaaggtagctgtgtacagagct
cagcctgtggtgatggccactgtccaactgatggttcaagactctctgaatcccacactg
aagaactgtgtcctggagcagaccaagacaccagtcagctgcttcaacgtccagatgtgc
gtgggagccacaggacacaacattccccagaagcttcacctaaaggcagagctgcagctg
gacctacagaagccccgtcaggcccgccgggtgctcctgctggcctctcgacaggcgagc
ctcactctgagcctggacctgggtggaagaaacaaacctatctgccacaccatcaaggcc
ttccttcgagatgaggccgacttccgggacaagctgagcccaattgtgctaagcctcaat
gtgtcgctgcccccagaagagactggagtagcccctgctgtggtgttgcatggagtaacc
catgtccaggagcagacacggatcatcctggactgtggggaagacaacctgtgcgtgccc
cagctccagctcacagccaccgcgggggactccccactcctaattggtgctgacaatgtg
ttggagctgaaggtcaatgcatccaatgatggcgagggggcctatgaggcagagctggct
gtgcacttacccccgggtgcccactacattcgggctttcagcaacgttaagggctttgag
aggctcgtgtgcactcagaagaaggagaatgagtccaggctggcactttgtgagctgggc
aaccccatgaaaaaggacactcggataggaatcacgatgttggtgagtgtggagatcctg
gaagaagctggagattctgtgtccttccagcttcaaatcaggagcaagaacagccagaat
ccaaacagtgaggctgtgctgttgcctgtggcagtccgagctgaagccgcagtggagctt
cgagggaactccttccctgcctccctggtggtggcagcagaagaagttgacaaggagcag
gatggtttggacagctgggtctccagggtggaacacacctatgagctccacaacaatggc
cctggcactgtgaacggcctcagtctcatcatccaccttcctggccagtcccagccctca
gatctgctctacatcctagatgtgcagccgaaggggggtctcctttgctccacacagccg
ccccccaagctcctcaaggtggaccggaggctaaccactcccagcccttcttccattcgc
cggatccatcacgaccgggaccgcagagaggcatccccgcaggggtccaagcagacggag
cagcaggacccagttctggtgagctgcaacggctcagcgccctgtacggtggtggagtgt
gaactgcaggagatggtgcgcgggcagcgggccatggtcacggtgcaggccacgctgggg
ctgtccatcctccgccagaggccccaggagcagtttgtgctgcagtcgcacgcctggttc
aacgtctcctccctaccgtactcggtgccggtggtcagcttgcccagcgggcaaggtctg
gtgcagacacatctgcttcgggccttggaggagagggacatccctgtctggtgggtgctg
gtaggcgtgctgggcggtctgctgctgctgaccctactagttttggccatgtggaaggct
ggcttcttcaagcggaatcgaccacctctggaggaagaggaagaggaagaatga

DBGET integrated database retrieval system