KEGG   Rattus norvegicus (rat): 114906
Entry
114906            CDS       T01003                                 

Symbol
Pkia
Name
(RefSeq) cAMP-dependent protein kinase inhibitor alpha
  KO
K15985  cAMP-dependent protein kinase inhibitor alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    114906 (Pkia)
SSDB
Motif
Pfam: PKI
Other DBs
NCBI-GeneID: 114906
NCBI-ProteinID: NP_446224
RGD: 621021
Ensembl: ENSRNOG00000012095
UniProt: P63249
Position
2
AA seq 76 aa
MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEDDGQRSS
TEQSGEAQGEAAKSES
NT seq 231 nt   +upstreamnt  +downstreamnt
atgactgatgtggaaactacgtatgcagattttattgcctcaggaagaacaggtagaaga
aatgcaatacatgatatcttggtttcctctgcaagtggcaacagcaatgaattagccttg
aaattagcaggtcttgatattaacaagacagaaggtgaagatgatggacagagaagctcc
acagaacaaagtggcgaagcccagggagaagcagccaagtctgaaagctaa

DBGET integrated database retrieval system