KEGG   Rattus norvegicus (rat): 116560
Entry
116560            CDS       T01003                                 

Gene name
Kcnj9
Definition
(RefSeq) G protein-activated inward rectifier potassium channel 3
  KO
K05002  potassium inwardly-rectifying channel subfamily J member 9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04713  Circadian entrainment
rno04723  Retrograde endocannabinoid signaling
rno04726  Serotonergic synapse
rno04728  Dopaminergic synapse
rno04915  Estrogen signaling pathway
rno04921  Oxytocin signaling pathway
rno04929  GnRH secretion
rno05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    116560 (Kcnj9)
   04915 Estrogen signaling pathway
    116560 (Kcnj9)
   04921 Oxytocin signaling pathway
    116560 (Kcnj9)
  09156 Nervous system
   04728 Dopaminergic synapse
    116560 (Kcnj9)
   04726 Serotonergic synapse
    116560 (Kcnj9)
   04723 Retrograde endocannabinoid signaling
    116560 (Kcnj9)
  09159 Environmental adaptation
   04713 Circadian entrainment
    116560 (Kcnj9)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    116560 (Kcnj9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    116560 (Kcnj9)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   116560 (Kcnj9)
SSDB
Motif
Pfam: IRK_C IRK Ion_trans_2
Other DBs
NCBI-GeneID: 116560
NCBI-ProteinID: NP_446286
RGD: 621440
Ensembl: ENSRNOG00000007645
UniProt: Q63511
Position
13
AA seq 393 aa
MAQENAAFSPGSEEPPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLS
LLFFVLAYALTWLFFGAIWWLIAYGRGDLEHLEDTAWTPCVNNLNGFVAAFLFSIETETT
IGYGHRVITDQCPEGIVLLLLQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVS
LRDGRLCLMFRVGDLRSSHIVEASIRAKLIRSRQTLEGEFIPLHQTDLSVGFDTGDDRLF
LVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMVEATGMTCQARSSYLVDEVLW
GHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLYWSIPSRLDEK
VEEEGAGEGAGAGDGADKEQNGCLPPPESESKV
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggcgcaggagaacgccgctttctctcccgggtcggaggagccaccgcggcgccgcggt
cgccagcgctacgtggagaaggacgggcgctgcaacgtgcagcagggcaacgtccgcgag
acctaccgctacctgaccgacctgttcaccacgctggtagatctgcagtggcgcctcagc
ctgctcttcttcgtgctcgcctacgcgctcacctggctcttcttcggcgccatctggtgg
ctcatcgcctacggccgcggcgacctggagcacctggaggacaccgcgtggacaccgtgc
gtcaacaacctcaacggcttcgtggccgccttcctcttctccatcgagacagaaaccacc
atcggctatgggcaccgtgtcatcaccgaccagtgccccgagggcatcgtgctgctgctg
ttgcaagccatcctgggctccatggtgaacgctttcatggtgggctgcatgttcgtcaag
atctcgcagcccaacaagcgcgccgccacgctcgtcttctcctcgcacgccgtggtgtct
ctgcgcgacgggcgcctctgtctcatgtttcgcgtgggggacctgcgatcctcgcacatc
gtcgaggcctccatccgcgccaagctcatccgctcgcgccagacgctcgagggcgagttc
atccctctgcaccagaccgacctcagcgtgggcttcgacacgggggacgaccgcctcttc
ctcgtctcacctctcgtcatcagccatgagatcgacgccgccagccccttctgggaggca
tcgcgccgcgccctcgagagggacgacttcgagatcgtagtcattctcgagggcatggtg
gaagccacgggaatgacgtgccaagctcgaagctcgtacctggtagacgaagtgttgtgg
ggccaccgattcacatccgtgctcaccctggaggacggtttctatgaggtggactacgct
agcttccatgaaacctttgaggtgcccacaccctcatgcagtgctcgggaactggcagaa
gctgcagcccgccttgacgcccatctctactggtccatccccagcaggctggatgagaag
gtggaggaagaaggggctggggagggggcaggcgcaggagatggagctgacaaggagcaa
aatggctgcctgccacccccggagagtgagtccaaggtgtga

KEGG   Rattus norvegicus (rat): 25743
Entry
25743             CDS       T01003                                 

Gene name
Kcnj6
Definition
(RefSeq) G protein-activated inward rectifier potassium channel 2
  KO
K05000  potassium inwardly-rectifying channel subfamily J member 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04713  Circadian entrainment
rno04723  Retrograde endocannabinoid signaling
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04727  GABAergic synapse
rno04728  Dopaminergic synapse
rno04915  Estrogen signaling pathway
rno04921  Oxytocin signaling pathway
rno04929  GnRH secretion
rno05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    25743 (Kcnj6)
   04915 Estrogen signaling pathway
    25743 (Kcnj6)
   04921 Oxytocin signaling pathway
    25743 (Kcnj6)
  09156 Nervous system
   04727 GABAergic synapse
    25743 (Kcnj6)
   04725 Cholinergic synapse
    25743 (Kcnj6)
   04728 Dopaminergic synapse
    25743 (Kcnj6)
   04726 Serotonergic synapse
    25743 (Kcnj6)
   04723 Retrograde endocannabinoid signaling
    25743 (Kcnj6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    25743 (Kcnj6)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    25743 (Kcnj6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    25743 (Kcnj6)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   25743 (Kcnj6)
SSDB
Motif
Pfam: IRK_C IRK Ion_trans_2
Other DBs
NCBI-GeneID: 25743
NCBI-ProteinID: NP_037324
RGD: 2959
Ensembl: ENSRNOG00000001658
UniProt: P48550 Q54A91
Position
11
AA seq 425 aa
MTMAKLTESMTNVLEGDSMDQDVESPVAIHQPKLPKQARDDLPRHISRDRTKRKIQRYVR
KDGKCNVHHGNVRETYRYLTDIFTTLVDLKWRFNLLIFVMVYTVTWLFFGMIWWLIAYIR
GDMDHIEDPSWTPCVTNLNGFVSAFLFSIETETTIGYGYRVITDKCPEGIILLLIQSVLG
SIVNAFMVGCMFVKISQPKKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIR
AKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLP
KEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETY
ETSTPSLSAKELAELANRAELPLSWSVSSKLNQHAELETEEEEKNPEELTERNGDVANLE
NESKV
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgacaatggccaagttaactgaatccatgactaatgtcctggagggggattccatggac
caagacgtggaaagcccagtggccattcaccagccaaagttgcctaagcaggccagggat
gacctgccaagacacatcagccgagacaggaccaaaaggaaaatccagaggtacgtgagg
aaggatgggaagtgtaacgtccaccacggcaacgtgcgggagacgtaccgatacctgacg
gacatcttcaccaccctggtggacctaaagtggagattcaacctattgatctttgtcatg
gtctacacagtgacgtggcttttctttgggatgatctggtggctaattgcatacatccgg
ggagatatggaccacatagaggacccctcgtggactccctgtgttaccaacctcaacggg
tttgtctccgcttttttattctcaatagagacagaaaccaccattggttatggctacagg
gtcatcacggacaagtgcccagaaggaattattctcctcttaatccagtccgtgttgggg
tccattgtcaacgccttcatggtaggatgtatgtttgtgaaaatatcccaacccaagaag
agggcagagaccctggtcttttccacccatgcggtaatctccatgcgggatgggaaacta
tgcctgatgttccgggtaggggacttgaggaattcccacattgtggaggcctccatcaga
gccaagttgatcaagtccaaacagacttcagagggggagttcattcccctcaaccagacg
gatatcaacgtagggtactacaccggggatgaccgactctttctcgtgtcaccgctgatt
attagccatgaaattaaccaacagagtcccttctgggagatctccaaagcccagctgcct
aaagaggaactggagattgtggtcatcctggagggaatggtggaagccacaggaatgacg
tgccaagctcgaagctcctacatcaccagtgagatcctgtggggttaccggttcacacca
gtcctgacactggaggacgggttctatgaagttgactacaacagcttccatgagacctat
gagaccagcaccccgtcccttagcgccaaagagctagccgagctggctaaccgggcagag
ctgcccctgagctggtctgtgtccagcaaactgaaccaacatgcagaactggagacggaa
gaggaagagaagaacccggaagaactgacagagaggaatggtgatgtggcaaacctagag
aatgagtccaaagtgtag

KEGG   Rattus norvegicus (rat): 29713
Entry
29713             CDS       T01003                                 

Gene name
Kcnj5
Definition
(RefSeq) G protein-activated inward rectifier potassium channel 4
  KO
K04999  potassium inwardly-rectifying channel subfamily J member 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04713  Circadian entrainment
rno04723  Retrograde endocannabinoid signaling
rno04726  Serotonergic synapse
rno04728  Dopaminergic synapse
rno04915  Estrogen signaling pathway
rno04921  Oxytocin signaling pathway
rno04925  Aldosterone synthesis and secretion
rno04929  GnRH secretion
rno05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    29713 (Kcnj5)
   04915 Estrogen signaling pathway
    29713 (Kcnj5)
   04921 Oxytocin signaling pathway
    29713 (Kcnj5)
   04925 Aldosterone synthesis and secretion
    29713 (Kcnj5)
  09156 Nervous system
   04728 Dopaminergic synapse
    29713 (Kcnj5)
   04726 Serotonergic synapse
    29713 (Kcnj5)
   04723 Retrograde endocannabinoid signaling
    29713 (Kcnj5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    29713 (Kcnj5)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    29713 (Kcnj5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    29713 (Kcnj5)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   29713 (Kcnj5)
SSDB
Motif
Pfam: IRK_C IRK Ion_trans_2
Other DBs
NCBI-GeneID: 29713
NCBI-ProteinID: NP_058993
RGD: 61971
Ensembl: ENSRNOG00000033796
UniProt: P48548
Position
8
AA seq 419 aa
MAGDSRNAMNQDMEIGVTSQDHKKIPKQARDYIPIATDRTRLLPEGKKPRQRYMEKTGKC
NVHHGNVQETYRYLSDLFTTLVDLKWRFNLLVFTMVYTITWLFFGFIWWLIAYVRGDLDH
VGDQEWIPCVENLSGFVSAFLFSIETETTIGYGFRVITEKCPEGIILLLVQAILGSIVNA
FMVGCMFVKISQPKKRAETLMFSNNAVISMRDEKLCLMFRVGDLRNSHIVEASIRAKLIK
SRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLIISHEINEKSPFWEMSRAQLEQEEFE
VVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHDTYETNTP
SCCAKELAEMKRNGQLLQSLPSPPLLGGCAEAEKEAEAEHDEEEEPNGLSVSRATRGSM
NT seq 1260 nt   +upstreamnt  +downstreamnt
atggccggtgattctaggaatgctatgaatcaagacatggagataggagtcacctcccag
gaccacaagaagatccccaaacaggctcgggattacatccccattgccacagaccgcact
cgcctgctgccggaaggcaagaagccacgccagcgctacatggagaagaccggcaagtgt
aacgtgcaccatggcaatgttcaggaaacctaccgctacctaagtgacctcttcaccacc
ctggtggacctcaaatggcgcttcaaccttctggtcttcaccatggtctacaccattact
tggctattctttggcttcatctggtggctcattgcttatgtccgaggtgatctggaccac
gtgggtgaccaagagtggatcccttgtgttgaaaaccttagtggctttgtgtctgctttc
ctgttctccattgagacagaaacaaccattgggtatggcttcagagtcattacagagaag
tgtccagaggggatcattctccttctagtgcaggccatcctgggctctattgttaatgcc
ttcatggtgggttgcatgtttgtaaagatcagccagccaaagaagagagcagagaccctc
atgttctccaacaatgctgtcatctccatgcgggatgagaagctgtgcctcatgttccgg
gtaggggacctccgaaactcccatatcgtggaggcctccatccgcgccaagcttatcaag
tcccggcagaccaaagaaggggaattcatccccttgaaccagaccgacattaacgtgggc
tttgacactggtgacgaccgcctcttcctggtgtcccccctcatcatctcccatgagatc
aatgagaagagccctttctgggagatgtctcgtgctcaactggagcaggaagagttcgag
gttgtggtcatactagaagggatggtagaagccacaggcatgacttgccaagcacggagc
tcttacatggatacagaggtgctctggggtcaccgattcacaccagtcctcaccttggaa
aagggcttctatgaggtggactacaacactttccacgacacctatgagaccaacacaccc
agctgctgtgccaaggagctggcagaaatgaagaggaatggtcagctcctccagtccttg
cccagtcctcctttgcttgggggctgcgctgaggctgagaaagaagcagaggctgagcac
gatgaggaggaggaacccaatggactgagtgtgtcccgggcaacaaggggctcaatgtga

KEGG   Rattus norvegicus (rat): 50599
Entry
50599             CDS       T01003                                 

Gene name
Kcnj3
Definition
(RefSeq) G protein-activated inward rectifier potassium channel 1
  KO
K04997  potassium inwardly-rectifying channel subfamily J member 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04713  Circadian entrainment
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04728  Dopaminergic synapse
rno04915  Estrogen signaling pathway
rno04921  Oxytocin signaling pathway
rno04929  GnRH secretion
rno05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    50599 (Kcnj3)
   04915 Estrogen signaling pathway
    50599 (Kcnj3)
   04921 Oxytocin signaling pathway
    50599 (Kcnj3)
  09156 Nervous system
   04724 Glutamatergic synapse
    50599 (Kcnj3)
   04725 Cholinergic synapse
    50599 (Kcnj3)
   04728 Dopaminergic synapse
    50599 (Kcnj3)
   04726 Serotonergic synapse
    50599 (Kcnj3)
   04723 Retrograde endocannabinoid signaling
    50599 (Kcnj3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    50599 (Kcnj3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    50599 (Kcnj3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    50599 (Kcnj3)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   50599 (Kcnj3)
SSDB
Motif
Pfam: IRK_C IRK
Other DBs
NCBI-GeneID: 50599
NCBI-ProteinID: NP_113798
RGD: 2958
Ensembl: ENSRNOG00000005369
UniProt: P63251
Position
3
AA seq 501 aa
MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQGPQQQLVPKKKRQRFVDKNGRCNVQHGNL
GSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNY
TPCVANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCM
FIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPE
GEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQFEVVVILE
GIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKE
QEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDISTKLPSKLQKITGREDFPKKLLRMS
STTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGG
PTRMEGNLPAKLRKMNSDRFT
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgtctgcactccgaaggaaatttggggacgattaccaggtagtgaccacttcgtccagc
ggttcgggcttgcagccccaggggccaggacagggcccacagcagcagcttgtacccaag
aagaaacggcagcggttcgtggacaagaacggtcggtgcaatgtgcagcacggcaacctg
ggcagcgagaccagtcgctacctttccgacctcttcactaccctggtggatctcaagtgg
cgttggaacctctttatcttcatcctcacctacaccgtggcctggctcttcatggcgtcc
atgtggtgggtgatcgcttatacccggggcgacctgaacaaagcccatgtcggcaactac
actccctgtgtggccaatgtctataacttcccctctgccttccttttcttcatcgagacc
gaggccaccatcggctatggctaccgctacatcaccgacaagtgccccgagggcatcatc
cttttccttttccagtccatccttggctccatcgtggacgctttcctcatcggctgcatg
ttcatcaagatgtcccagcccaaaaagcgcgccgagaccctcatgtttagcgagcatgcg
gttatttccatgagggacggaaaactcactctcatgttccgggtgggcaacctgcgcaac
agccacatggtctccgcgcagatccgctgcaagctgctcaaatctcggcagacacctgag
ggtgagtttctaccccttgaccaacttgaactggatgtaggttttagtacaggggcagat
caactttttcttgtgtcccctctcaccatttgccacgtgattgatgccaaaagccccttt
tatgacctatcccagcgaagcatgcaaactgaacagttcgaggtggtcgtcatcctggaa
ggcatcgtggaaaccacagggatgacttgtcaagctcgaacatcatacaccgaagatgaa
gttctttggggtcatcgttttttccctgtaatttctttagaagaaggattctttaaagtc
gattactcccagttccatgcaacctttgaagtccccacccctccgtacagtgtgaaagag
caggaagaaatgcttctcatgtcttcccctttaatagcaccagccataaccaacagcaaa
gaaagacacaattctgtggagtgcttagatggactagatgacattagcacaaaacttcca
tcgaagctgcagaaaattacggggagagaagactttcccaaaaaactcctgaggatgagt
tctacaacttcagaaaaagcctatagtttgggtgatttgcccatgaaactccaacgaata
agttcggttcctggcaactctgaagaaaaactggtatctaaaaccaccaagatgttatca
gatcccatgagccagtctgtggccgatttgccaccgaagcttcaaaagatggctggagga
cctaccaggatggaagggaatcttccagccaaactaagaaaaatgaactctgaccgcttc
acatag

DBGET integrated database retrieval system