KEGG   Rattus norvegicus (rat): 116671
Entry
116671            CDS       T01003                                 

Gene name
Cdk5r1
Definition
(RefSeq) cyclin-dependent kinase 5 activator 1
  KO
K11716  cyclin-dependent kinase 5 activator 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05030  Cocaine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    116671 (Cdk5r1)
   05022 Pathways of neurodegeneration - multiple diseases
    116671 (Cdk5r1)
  09165 Substance dependence
   05030 Cocaine addiction
    116671 (Cdk5r1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    116671 (Cdk5r1)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    116671 (Cdk5r1)
SSDB
Motif
Pfam: CDK5_activator MTBP_C
Other DBs
NCBI-GeneID: 116671
NCBI-ProteinID: NP_446343
RGD: 629472
Ensembl: ENSRNOG00000021685
UniProt: P61810
Position
10
AA seq 307 aa
MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSA
KKKNSKKAQPNSSYQSNIAHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTG
VSSSVKKAPHPAITSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRS
VDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNE
ISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKR
LLLGLDR
NT seq 924 nt   +upstreamnt  +downstreamnt
atgggcacggtgctgtccctgtcccccagctatcgaaaggccacactgtttgaggatggc
gcggccaccgtgggccactacacggccgtgcagaacagcaagaacgccaaggacaagaac
ctgaagcggcactccatcatctcggtactgccttggaagaggatcgtggcggtgtcagcg
aagaagaagaactccaagaaggcgcagcccaacagcagctaccagagcaacatcgcgcac
ctcaacaatgagaacctgaagaagtcgctgtcgtgtgccaacctgtccacgttcgcccag
cccccgccggcccagccgcccgcacccccagccagccagctttctggctcccagactggg
gtctcctcttctgtcaagaaggccccgcaccctgccatcacctccgcaggaacacccaaa
cgggtcatcgtccaggcgtccactagtgagctgctgcgctgcctgggtgagtttctctgc
cgccggtgctaccgcctgaagcacttgtccccaacggaccccgtgctctggctgcgcagc
gtggaccgctccctgcttctgcagggatggcaggaccagggtttcatcacaccggccaat
gtggtcttcctctacatgctctgcagggatgttatctcctctgaggtgggctcggaccac
gagctccaggctgtcctgctgacctgtctgtacctctcctattcctacatgggcaatgaa
atctcctacccgctcaagcccttcctggtggagagctgcaaggaagccttttgggaccgt
tgcctctcagttatcaacctcatgagctccaagatgctgcagatcaatgctgacccacac
tatttcacacaagtgttctctgacttgaagaatgagagtggtcaggaggacaagaagcga
ctcctcctggggctcgatcggtga

DBGET integrated database retrieval system