KEGG   Rattus norvegicus (rat): 116700
Entry
116700            CDS       T01003                                 

Gene name
Cga
Definition
(RefSeq) glycoprotein hormones alpha chain precursor
  KO
K08522  glycoprotein hormones alpha chain
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04912  GnRH signaling pathway
rno04913  Ovarian steroidogenesis
rno04917  Prolactin signaling pathway
rno04918  Thyroid hormone synthesis
rno04923  Regulation of lipolysis in adipocytes
rno04929  GnRH secretion
rno05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    116700 (Cga)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    116700 (Cga)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    116700 (Cga)
   04929 GnRH secretion
    116700 (Cga)
   04912 GnRH signaling pathway
    116700 (Cga)
   04913 Ovarian steroidogenesis
    116700 (Cga)
   04917 Prolactin signaling pathway
    116700 (Cga)
   04918 Thyroid hormone synthesis
    116700 (Cga)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    116700 (Cga)
SSDB
Motif
Pfam: Hormone_6 DUF1218
Other DBs
NCBI-GeneID: 116700
NCBI-ProteinID: NP_446370
RGD: 620436
Ensembl: ENSRNOG00000009269
UniProt: Q6P509
Position
5
AA seq 120 aa
MDCYRRYAAVILVMLSMVLHILHPLPDGDLIIQGCPECKLKENKYFSKLGAPIYQCMGCC
FSRAYPTPARSKKTMLVPKNITSEATCCVAKSFTKATVMGNARVENHTDCHCSTCYYHKS
NT seq 363 nt   +upstreamnt  +downstreamnt
atggattgctacagaagatatgcggctgtcattctggtcatgctgtccatggtcctgcat
attcttcatcctcttcctgatggagaccttattattcagggttgtccagaatgtaaacta
aaggaaaacaaatacttctccaagctgggtgcccccatctatcagtgtatgggctgttgc
ttctccagggcatacccgactcccgcaaggtccaagaagacaatgttggttccaaagaat
attacctcggaggccacgtgctgtgtggccaaatcatttactaaggccacagtgatggga
aacgccagagtggagaaccacacggactgccactgtagcacttgttactaccacaagtcg
tag

KEGG   Rattus norvegicus (rat): 25447
Entry
25447             CDS       T01003                                 

Gene name
Fshb
Definition
(RefSeq) follitropin subunit beta precursor
  KO
K05250  follitropin subunit beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04912  GnRH signaling pathway
rno04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    25447 (Fshb)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25447 (Fshb)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    25447 (Fshb)
   04913 Ovarian steroidogenesis
    25447 (Fshb)
SSDB
Motif
Pfam: Cys_knot
Other DBs
NCBI-GeneID: 25447
NCBI-ProteinID: NP_001007598
RGD: 2630
Ensembl: ENSRNOG00000004898
UniProt: P18427 B5DEM1
Position
3
AA seq 130 aa
MMKSIQLCILLWCLRAVCCHSCELTNITISVEKEECRFCISINTTWCEGYCYTRDLVYKD
PARPNTQKVCTFKELVYETIRLPGCARHSDSLYTYPVATECHCGKCDSDSTDCTVRGLGP
SYCSFGEMKE
NT seq 393 nt   +upstreamnt  +downstreamnt
atgatgaagtcgatccagctttgcatcctactctggtgcttgagagcagtctgctgccat
agctgtgaactgaccaacatcaccatctcagtagagaaggaagagtgccgtttctgcata
agcatcaataccacttggtgtgagggctactgctacaccagggatctggtgtataaggac
ccagctagaccaaacacccagaaagtatgcaccttcaaggagctggtgtacgagaccata
agattgcctggctgtgcccgccactcagactccctctacacatatccagtagccactgaa
tgccactgtggcaagtgtgatagtgacagcaccgactgcactgtaagaggcctgggaccc
agctactgctccttcggtgaaatgaaagaataa

DBGET integrated database retrieval system