KEGG   Rattus norvegicus (rat): 117045
Entry
117045            CDS       T01003                                 

Gene name
Eif4e
Definition
(RefSeq) eukaryotic translation initiation factor 4E
  KO
K03259  translation initiation factor 4E
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno03013  RNA transport
rno04066  HIF-1 signaling pathway
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04211  Longevity regulating pathway
rno04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    117045 (Eif4e)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    117045 (Eif4e)
   04151 PI3K-Akt signaling pathway
    117045 (Eif4e)
   04150 mTOR signaling pathway
    117045 (Eif4e)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    117045 (Eif4e)
  09149 Aging
   04211 Longevity regulating pathway
    117045 (Eif4e)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    117045 (Eif4e)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    117045 (Eif4e)
   03012 Translation factors [BR:rno03012]
    117045 (Eif4e)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     117045 (Eif4e)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     117045 (Eif4e)
Translation factors [BR:rno03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    117045 (Eif4e)
SSDB
Motif
Pfam: IF4E
Other DBs
NCBI-GeneID: 117045
NCBI-ProteinID: NP_446426
RGD: 69647
Ensembl: ENSRNOG00000052343
Vega: OTTRNOG00000002187
UniProt: P63074
Position
2
AA seq 217 aa
MATVEPETTPTTNPPPAEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANL
RLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQ
QRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIG
RVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
NT seq 654 nt   +upstreamnt  +downstreamnt
atggcgactgtggaaccggaaaccacccctaccactaatcccccacctgcggaagaggaa
aaaacagagtctaatcaggaggttgctaatccagagcactatattaaacaccctctacag
aacaggtgggcactctggttttttaaaaatgataaaagcaaaacttggcaagcaaacctt
cggttgatctctaagtttgatactgttgaagacttttgggctctatacaaccatatccag
ttgtctagtaatttaatgcctggctgtgactactcactttttaaggatggtattgagcct
atgtgggaagatgagaaaaacaaacggggaggacgatggctaattacattgaacaagcag
cagagacgaagtgacctcgatcgcttttggctagagacactgctgtgccttattggagaa
tcttttgatgactacagtgatgacgtgtgtggagctgttgtcaatgttagagctaaaggt
gataagatagcaatatggacgactgaatgtgaaaacagagatgcagtcacacacataggg
agggtatacaaggaaaggttaggacttcctccgaagatagtgattggttatcagtcccac
gcagacacagctacaaagagcggctccaccactaaaaataggtttgttgtttaa

KEGG   Rattus norvegicus (rat): 363275
Entry
363275            CDS       T01003                                 

Gene name
Eif4e2
Definition
(RefSeq) eukaryotic translation initiation factor 4E type 2
  KO
K03259  translation initiation factor 4E
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno03013  RNA transport
rno04066  HIF-1 signaling pathway
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04211  Longevity regulating pathway
rno04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    363275 (Eif4e2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    363275 (Eif4e2)
   04151 PI3K-Akt signaling pathway
    363275 (Eif4e2)
   04150 mTOR signaling pathway
    363275 (Eif4e2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    363275 (Eif4e2)
  09149 Aging
   04211 Longevity regulating pathway
    363275 (Eif4e2)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    363275 (Eif4e2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    363275 (Eif4e2)
   03012 Translation factors [BR:rno03012]
    363275 (Eif4e2)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     363275 (Eif4e2)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     363275 (Eif4e2)
Translation factors [BR:rno03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    363275 (Eif4e2)
SSDB
Motif
Pfam: IF4E
Other DBs
NCBI-GeneID: 363275
NCBI-ProteinID: NP_001102278
RGD: 1307790
Ensembl: ENSRNOG00000019634
UniProt: D4A174
Position
9
AA seq 174 aa
MMTVETMIRMKKTAHRKMVRRKKQTEIRARVVEQFWKFYSHMVRPGDLTGHSDFHLFKEG
IKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDI
ISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKYVLGGLGGTGP
NT seq 525 nt   +upstreamnt  +downstreamnt
atgatgacagtggagaccatgatcagaatgaagaaaacagcacacagaaagatggtgaga
aggaaaaaacagaccgagataagagccagagtggtggaacagttctggaagttttacagc
cacatggtccgtcccggggacctgacaggccacagtgactttcatctctttaaagaagga
atcaaacctatgtgggaggatgatgcaaataaaaatgggggcaagtggatcattcgactc
cggaagggcttagcttcccgctgctgggagaatctcatcctggccatgctcggggaacag
ttcatggttggggaggagatctgcggggctgtggtctctgtccgcttccaggaggacatt
atttctatatggaataagactgccagcgaccaagcaaccacagcccgaatccgggacact
cttcggcgcgtgcttaacctacctcccaacaccattatggaatacaaaactcacaccgac
agcatcaagtacgtgttggggggtttgggggggacaggtccctga

KEGG   Rattus norvegicus (rat): 686104
Entry
686104            CDS       T01003                                 

Gene name
Eif4e1b
Definition
(RefSeq) eukaryotic translation initiation factor 4E type 1B
  KO
K03259  translation initiation factor 4E
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno03013  RNA transport
rno04066  HIF-1 signaling pathway
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04211  Longevity regulating pathway
rno04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    686104 (Eif4e1b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    686104 (Eif4e1b)
   04151 PI3K-Akt signaling pathway
    686104 (Eif4e1b)
   04150 mTOR signaling pathway
    686104 (Eif4e1b)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    686104 (Eif4e1b)
  09149 Aging
   04211 Longevity regulating pathway
    686104 (Eif4e1b)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    686104 (Eif4e1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    686104 (Eif4e1b)
   03012 Translation factors [BR:rno03012]
    686104 (Eif4e1b)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     686104 (Eif4e1b)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     686104 (Eif4e1b)
Translation factors [BR:rno03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    686104 (Eif4e1b)
SSDB
Motif
Pfam: IF4E CDC45 RPN2_C Nop14 DUF2052 Tim54 DDHD
Other DBs
NCBI-GeneID: 686104
NCBI-ProteinID: XP_038952114
RGD: 1585494
Ensembl: ENSRNOG00000025480
Position
17
AA seq 263 aa
MSKAEGEGQEEEEEEEEEEEKEEEEEEEEEEKEEEEEEEVKEKPSEATAEGLQGEARDLP
GSLKTVKQKAQREHPTKLPRELHPLQFRWVLWFFKNDRSRAWQDNLQLVTKFDTVEDFWA
TYRHVKLASKLSCGCDYALFKEGIQPMWEDSRNKRGGRWLLSLAKQQRHMELDRLWLETL
LCLLGESFEEYSGEVCGAVVNIRTKGDKIALWTSEAENKAGVMHIGHIYKERLGLSTKTI
IGYQAHADTAAKSNSLAKNKFVV
NT seq 792 nt   +upstreamnt  +downstreamnt
atgagcaaagctgagggtgaagggcaggaggaggaagaggaggaagaagaggaagaggag
aaggaagaggaggaggaagaagaggaagaggagaaggaagaggaagaggaggaggaggtg
aaagaaaagccatcagaagcaacagcggagggactccaaggagaagccagagacctacct
ggatcccttaagaccgtgaagcagaaggcccagagagaacatccaaccaagctcccgagg
gagctgcaccccctgcagttcaggtgggttctgtggttcttcaagaatgatcgaagccgg
gcctggcaggacaatctgcagttagtcaccaagtttgacactgtggaggacttctgggcg
acgtaccgccacgtcaagctggccagtaagctctcttgtggctgtgactacgctctgttc
aaggaaggcatccaacccatgtgggaagacagcagaaacaagcggggtggccgctggctg
ctcagtcttgccaaacagcagcgccacatggaactggaccgtctgtggctggagacattg
ctgtgtctactcggggagagttttgaggagtacagcggggaagtgtgtggcgccgtcgtc
aacatccgcaccaagggggacaagattgccctgtggacaagtgaagcagagaacaaggcc
ggtgtgatgcacatcgggcatatatacaaagagcgcctgggcctctccacgaagaccatc
attgggtaccaggcccatgcagacactgcggctaagagcaactctttagccaagaacaag
tttgtggtgtga

DBGET integrated database retrieval system