KEGG   Rattus norvegicus (rat): 117263
Entry
117263            CDS       T01003                                 

Gene name
Psmc1
Definition
(RefSeq) 26S proteasome regulatory subunit 4
  KO
K03062  26S proteasome regulatory subunit T2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03050  Proteasome
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05169  Epstein-Barr virus infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    117263 (Psmc1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    117263 (Psmc1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    117263 (Psmc1)
   05165 Human papillomavirus infection
    117263 (Psmc1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    117263 (Psmc1)
   05012 Parkinson disease
    117263 (Psmc1)
   05014 Amyotrophic lateral sclerosis
    117263 (Psmc1)
   05016 Huntington disease
    117263 (Psmc1)
   05017 Spinocerebellar ataxia
    117263 (Psmc1)
   05020 Prion disease
    117263 (Psmc1)
   05022 Pathways of neurodegeneration - multiple diseases
    117263 (Psmc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:rno03051]
    117263 (Psmc1)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     117263 (Psmc1)
SSDB
Motif
Pfam: AAA AAA_lid_3 Prot_ATP_ID_OB AAA_2 AAA_22 DUF815 RuvB_N AAA_5 AAA_16 AAA_18 AAA_25 AAA_33 ATPase IstB_IS21 AAA_28 AAA_3 RNA_helicase AAA_14 Mg_chelatase TIP49 AAA_7 Prot_ATP_OB_N NACHT PhoH AAA_24 AAA_30 NB-ARC ABC_tran Parvo_NS1 TsaE Sigma54_activat
Other DBs
NCBI-GeneID: 117263
NCBI-ProteinID: NP_476464
RGD: 621097
Ensembl: ENSRNOG00000003951
UniProt: P62193
Structure
PDB: 
6EPF 6EPC 6EPE 6EPD

Position
6
AA seq 440 aa
MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTPHTQCRL
KLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNH
AIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAP
QETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVA
NQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSG
GEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKT
KKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFK
KSKENVLYKKQEGTPEGLYL
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgggtcaaagtcagagtggtggccatggtcctgggggtggcaagaaggatgacaaggac
aagaaaaagaaatatgaacctcctgtcccaactagagtggggaaaaagaagaagaaaacc
aagggaccagatgctgccagcaaactgccactggtaacacctcacacccagtgccgcctg
aaattactaaagctggagagaataaaagactatcttctcatggaggaagaattcattaga
aatcaggaacagatgaaaccactagaagaaaagcaagaggaggaaagatcaaaggtggat
gatcttaggggaacccccatgtctgtaggaaccttggaagagatcatcgatgataatcac
gccattgtgtccacatcggtgggctcagaacactacgtcagcatcctgtcatttgtagac
aaggatctgctggaaccgggctgttcagtcctgctcaaccacaaggtgcatgctgtgata
ggggtgctcatggatgacacggatcccctggtcacagtgatgaaggtggaaaaggccccc
caggaaacctatgcagatattgggggactggacaaccagatccaggaaattaaggaatct
gtggagctccctcttacccaccctgagtattatgaggagatggggataaaaccacctaag
ggggtcattctctacggcccgccagggacaggtaaaactctattggccaaagcagtagcg
aaccagacttcagcgactttcttgcgagtggttggctcagagcttattcagaagtaccta
ggtgacgggcccaagctggtccgggagctcttccgggtcgctgaggaacacgcaccgtcc
attgtgttcattgatgaaatcgacgccattgggaccaaaagatatgattcaaactctgga
ggtgagcgggaaatccagcggacaatgttggaactgttgaaccagttggatggatttgat
tcgaggggagatgtaaaagttatcatggccacaaaccgaatagaaactttggatccagca
cttatcagaccaggccgcattgacagaaagatcgagttccccctgcctgatgaaaagacc
aagaagcgcatcttccagatccacacaagcaggatgacgctggctgatgatgtaaccttg
gatgacttgatcatggcaaaggatgacctctctggggctgacatcaaggcaatctgcaca
gaggctggcttgatggctctgcgggaacgcaggatgaaagtgacaaacgaagacttcaag
aaatctaaggagaacgttctgtataaaaaacaagaaggcacccctgaggggctgtatctc
tag

DBGET integrated database retrieval system