KEGG   Rattus norvegicus (rat): 117512
Entry
117512            CDS       T01003                                 

Symbol
C9
Name
(RefSeq) complement component C9
  KO
K04000  complement component 9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno05020  Prion disease
rno05146  Amoebiasis
rno05171  Coronavirus disease - COVID-19
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    117512 (C9)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    117512 (C9)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    117512 (C9)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    117512 (C9)
  09164 Neurodegenerative disease
   05020 Prion disease
    117512 (C9)
SSDB
Motif
Pfam: MACPF Ldl_recept_a TSP1_spondin TSP_1
Other DBs
NCBI-GeneID: 117512
NCBI-ProteinID: NP_476487
RGD: 620319
Ensembl: ENSRNOG00000013736
UniProt: Q62930 Q5BKC4
Position
2
AA seq 567 aa
MLLRTPGLPRRSGMASGVTITLAIAIFALEINAQAPEPTPREEPSADALLPIDCRMSTWS
QWSQCDPCLKQRFRSRSIEVFGQFQGKSCADALGDRQHCEPTQECEEVQENCGNDFQCET
GRCIKRKLLCNGDNDCGDFSDESDCESDPRLPCRDRVVEESELGRTAGYGINILGMDPLG
TPFDNEFYNGLCDRVRDGNTLTYYRKPWNVAFLAYETKADKNFRTENYEEQFEMFKTIVR
DRTTSFNANLALKFTITEAPIKKVGVDEVSPEKNSSKPKDSSVDFQFSYFKKENFQRLSS
YLSQTKKMFLHVRGMIQLGRFVMRNRGVMLTTTFLDDVKALPVSYEKGEYFGFLETYGTH
YSSSGSLGGLYELIYVLDKASMKEKGVELSDVKRCLGFNLDVSLYTPLQTTLEGPSLTAN
VNHSDCLKTGDGKVVNISRDHIIDDVISFIRGGTRKQAVLLKEKLLRGAKTIDVNDFINW
ASSLDDAPALISQKLSPIYNLIPLTMKDAYAKKQNMEKAIEDYVNEFSARKCYPCQNGGT
AILLDGQCMCSCTIKFKGIACEISKQR
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgcttctcaggactccagggctgcctaggaggagcggcatggcctcaggcgtgaccatc
accctagccattgcaatctttgccttggagatcaatgcacaggccccagagcccactccc
cgggaagagccatcagcagacgccctcctaccaatagactgcagaatgagcacatggagt
cagtggtcacagtgtgatccttgcctcaaacaaaggtttcgctcaagaagcattgaagtc
tttggacagtttcaggggaaaagctgtgctgatgctttgggagacagacaacattgtgaa
cccactcaggagtgtgaagaggtacaggaaaactgtgggaatgactttcagtgtgaaaca
ggcaggtgcataaagaggaaacttctgtgtaatggtgacaacgactgtggagatttttct
gatgagagtgactgtgaaagtgacccacgcctcccgtgccgtgaccgagtggtagaagaa
tcagaactgggacgaacagcaggctatgggatcaacatcttagggatggatcccctgggc
acgccttttgacaatgagttctacaatggactctgtgaccgggtacgggacggaaacact
ttgacatactatcgcaaaccttggaacgtagcatttctggcctatgaaaccaaggctgac
aaaaatttcagaactgagaattatgaagaacagtttgaaatgttcaaaaccatcgtccga
gacaggaccacgagttttaatgcaaatttagctctaaaattcacaatcactgaagcacct
ataaaaaaagttggagttgatgaagtcagcccagaaaaaaactcttcaaagcctaaagac
tcttctgttgattttcaattttcatatttcaagaaagaaaattttcaacgattgtcatcc
tacttgtcacagacgaaaaagatgtttctgcacgtgagaggaatgattcaactggggaga
tttgtcatgaggaatcggggcgttatgctgacgacaactttcctggatgatgtaaaggct
ttaccagtttcctatgaaaagggagaatattttggatttttggaaacctatgggactcac
tacagtagctctgggtccctgggagggctctacgaactgatctatgtcttggataaagct
tccatgaaagagaaaggtgttgaactgagcgatgtaaagcggtgtcttgggtttaacctg
gatgtttctctatatacgcctctacaaaccaccttagaaggaccatcattgacagccaat
gttaatcacagtgattgcttaaagacaggggatggtaaagtagtaaacatcagccgcgat
cacatcatagatgatgttatttcattcataagaggagggaccaggaagcaagcagttctc
ctgaaagagaagcttctcagaggagccaagacgattgatgtgaatgacttcatcaactgg
gcctcatccttggatgacgctccagctctcattagtcaaaaactgtcccctatctataat
ctcattcctttgacaatgaaagatgcatacgcaaagaaacagaatatggaaaaggctatt
gaagactatgtgaatgaattcagtgctagaaagtgctacccatgtcaaaacggaggcaca
gcaattcttctggatggacagtgcatgtgctcctgcacaatcaagtttaaggggattgcc
tgcgaaatcagtaaacaaagatag

DBGET integrated database retrieval system