KEGG   Rattus norvegicus (rat): 117517
Entry
117517            CDS       T01003                                 

Symbol
C7
Name
(RefSeq) LOW QUALITY PROTEIN: complement component C7
  KO
K03996  complement component 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno05020  Prion disease
rno05171  Coronavirus disease - COVID-19
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    117517 (C7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    117517 (C7)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    117517 (C7)
  09164 Neurodegenerative disease
   05020 Prion disease
    117517 (C7)
SSDB
Motif
Pfam: MACPF Kazal_3 Sushi Ldl_recept_a
Other DBs
NCBI-GeneID: 117517
NCBI-ProteinID: XP_038959452
RGD: 620318
Ensembl: ENSRNOG00000061379
Position
2
AA seq 847 aa
MKATSLLILVGFMTEFQIFSRASSPVNCEWDSYGPWSECNGCTKTQTRRRSIAVYGQYGG
HRCVGSAFETQSCNPERGCPTEEGCGDRFRCFSGQCISKSLVCNGDSDCEEDGADEDRCE
GAESRPSCDTVKPPPNIELTGNGYNALTGQFRNRVINTKSFGGQCRKVFSGDGRDFYRLS
GNILSYTFQVKIDNDFNYEFYNSSWSYVKHTSTDYTSSSSNRFLFFSSSSNRHTQSSSTK
EIYMKKSYKLLVVQNTVEVAQFINNNPEFXQLAEPFWRELSHLPTLYDYSAYRRLIDQYG
THYLQSGSLGGEYRVLFYVDSGDVKHRGFGSVQEKACSSSDFKFIFVSSANQRCKELENI
FKSNSGNQGRVPSRRAICHRWSPGFVADLVFLDLDNPAXNRQRYSSWASSVTGLPQVINR
GYLTPLYELVKEVPCASVKRLYLKRALEEYLDEFDPCHCRPCQNGGIASVVGTQCQCHCK
PYTYGMACEQGVLVGDQAGGVDGGWSCWSSWSPCVQGRNXRSRECNNPPPRAGGKACIGX
TTESXQCEDQDLENLRLLEPHCFHLSLVPKGFCPSPPALKDGFVQSEGTMFPIGKNIVYA
CNEGYSLVGDPVARCGEDLQWLVGEMHCQKIACFLPGGMNGMRSDPQKPFYMVGEKVTPF
LCXGGMSLEGPSTFLCGSSLKWSPELKSAQCVQKVTSTLTPAAPACQPWEKLKNSKCVCK
MPYECGSSLDVCARDERSNRILPLTICKMHVLQCQGRNYALVGKNSCTLPASTEKACGAC
PIWSKCDAQNSKCVCREASECQKAGYRICVEVNGKEETMSECEAGILRCRGQSISITAIK
PCAQEVQ
NT seq 2544 nt   +upstreamnt  +downstreamnt
atgaaggcaacaagcttattaattttggtgggatttatgacagagtttcaaatcttctca
agagcctcctctccagtcaactgtgagtgggactcctatggcccttggtcagaatgtaat
ggctgtaccaagactcagactcgaaggcgttcgattgctgtttatgggcaatatggaggc
catcggtgtgtggggagtgcttttgaaacacaatcctgcaaccctgaacgaggctgtcca
actgaagagggctgtggggaccggtttaggtgtttttcaggtcagtgcatcagcaaatcg
ttggtttgcaatggggattctgactgtgaggaagatggtgctgatgaagacagatgcgag
ggtgccgaaagcagaccttcctgtgacactgttaaaccccctcccaacatagaacttacc
ggcaacggttacaatgcacttactggccagtttaggaacagagtcatcaacaccaaaagt
ttcggtggtcagtgcaggaaagtgttcagcggggacggaagagatttctacagactgagt
ggaaatatcctctcttatacctttcaggtcaaaatagataatgattttaactatgaattt
tacaacagcagttggtcttacgtaaagcatacatccacagactatacatcatctagttca
aacaggttcttatttttctcctcctcatcaaatcgacacactcagagttcaagtaccaag
gaaatctacatgaaaaagagttataaactgttggttgttcagaacacggttgaagtggcc
cagtttattaataataatcctgaatttntacaacttgcggagccattctggagggaactc
tcccaccttcccactctgtatgactatagtgcctaccgacggttaattgaccagtatggg
acacattacctgcagtccgggtccttaggaggagaatatagagttctattttatgtggat
tcaggagatgtcaaacacaggggatttggatctgtccaggagaaggcatgttcctcttca
gactttaagtttatttttgtatcatcagcaaatcagagatgtaaggaactggaaaacatt
ttcaagtcaaattcaggaaaccagggcagggtgccttcgaggagagccatctgtcatcgg
tggagccctggctttgtagctgacctagttttcctggacctggataatcctgctnggaac
agacagcgctactcctcctgggccagctctgtaacaggtcttccccaagtcataaacaga
gggtatctgacaccgttgtacgagctggtcaaggaagtgccctgtgcctctgtgaaaaga
ctgtacctgaagcgggctcttgaggagtacttagatgaatttgacccctgccattgccgg
ccttgccagaatggtggcatcgctagtgttgtggggacacagtgccagtgtcactgcaaa
ccatacacatatggtatggcgtgtgagcaaggagtccttgtcggcgatcaagcaggaggg
gttgatggaggctggagctgttggtcctcttggagcccctgtgttcaaggaagaaatnnc
aggagccgagaatgcaataatccccctcccagagcgggtggaaaggcctgtattggataa
acgactgaaagcnagcagtgcgaagaccaggacttggagaacttgcgattacttgagcca
cattgctttcatttgtctttggttccaaaaggattctgcccatcaccccctgccttaaaa
gatggatttgttcaaagtgaaggtaccatgtttcctattggaaaaaacatagtatatgct
tgcaatgaagggtattctcttgtcggagatcctgttgccagatgtggagaagacttacag
tggcttgtgggggaaatgcactgtcaaaaaattgcctgttttctacctggagggatgaat
ggcatgcggagtgacccccagaaacccttctacatggttggtgagaaggtgacccctttc
ctgtgcnacggtggtatgtccttagaaggtccttccaccttcctctgcggctccagcctt
aagtggagtcctgagctgaagagtgcccagtgtgtgcaaaaagtcaccagcactctaaca
ccagcagctcctgcatgtcagccctgggagaaactgaagaactcaaaatgcgtctgcaaa
atgccctatgagtgcggatcctccttggatgtgtgtgcccgagatgagcgaagcaacagg
atactgcctttgaccatctgcaagatgcatgttctccagtgtcagggaagaaattatgct
ctcgttggcaagaacagctgtactctgcctgcctcgactgagaaagcgtgtggtgcatgc
ccaatatggagcaaatgtgatgctcagaacagcaaatgtgtctgcagagaagcgtcggag
tgccagaaagcagggtacagaatctgcgtggaagtgaatggcaaagaggagacaatgtcc
gagtgcgaggctggcatcttaaggtgcagagggcagagcatctccatcacagccataaag
ccctgtgcccaagaagtccagtag

DBGET integrated database retrieval system