KEGG   Rattus norvegicus (rat): 117517
Entry
117517            CDS       T01003                                 

Symbol
C7
Name
(RefSeq) LOW QUALITY PROTEIN: complement component C7
  KO
K03996  complement component 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno05020  Prion disease
rno05171  Coronavirus disease - COVID-19
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    117517 (C7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    117517 (C7)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    117517 (C7)
  09164 Neurodegenerative disease
   05020 Prion disease
    117517 (C7)
SSDB
Motif
Pfam: MACPF Kazal_3 Sushi Ldl_recept_a
Other DBs
NCBI-GeneID: 117517
NCBI-ProteinID: XP_038959452
RGD: 620318
Ensembl: ENSRNOG00000061379
Position
2
AA seq 847 aa
MKATSLLILVGFMTEFQIFSRASSPVNCEWDSYGPWSECNGCTKTQTRRRSIAVYGQYGG
HRCVGSAFETQSCNPERGCPTEEGCGDRFRCFSGQCISKSLVCNGDSDCEEDGADEDRCE
GAESRPSCDTVKPPPNIELTGNGYNALTGQFRNRVINTKSFGGQCRKVFSGDGRDFYRLS
GNILSYTFQVKIDNDFNYEFYNSSWSYVKHTSTDYTSSSSNRFLFFSSSSNRHTQSSSTK
EIYMKKSYKLLVVQNTVEVAQFINNNPEFXQLAEPFWRELSHLPTLYDYSAYRRLIDQYG
THYLQSGSLGGEYRVLFYVDSGDVKHRGFGSVQEKACSSSDFKFIFVSSANQRCKELENI
FKSNSGNQGRVPSRRAICHRWSPGFVADLVFLDLDNPAXNRQRYSSWASSVTGLPQVINR
GYLTPLYELVKEVPCASVKRLYLKRALEEYLDEFDPCHCRPCQNGGIASVVGTQCQCHCK
PYTYGMACEQGVLVGDQAGGVDGGWSCWSSWSPCVQGRNXRSRECNNPPPRAGGKACIGX
TTESXQCEDQDLENLRLLEPHCFHLSLVPKGFCPSPPALKDGFVQSEGTMFPIGKNIVYA
CNEGYSLVGDPVARCGEDLQWLVGEMHCQKIACFLPGGMNGMRSDPQKPFYMVGEKVTPF
LCXGGMSLEGPSTFLCGSSLKWSPELKSAQCVQKVTSTLTPAAPACQPWEKLKNSKCVCK
MPYECGSSLDVCARDERSNRILPLTICKMHVLQCQGRNYALVGKNSCTLPASTEKACGAC
PIWSKCDAQNSKCVCREASECQKAGYRICVEVNGKEETMSECEAGILRCRGQSISITAIK
PCAQEVQ
NT seq 2544 nt   +upstreamnt  +downstreamnt
atgaaggcaacaagcttattaattttggtgggatttatgacagagtttcaaatcttctca
agagcctcctctccagtcaactgtgagtgggactcctatggcccttggtcagaatgtaat
ggctgtaccaagactcagactcgaaggcgttcgattgctgtttatgggcaatatggaggc
catcggtgtgtggggagtgcttttgaaacacaatcctgcaaccctgaacgaggctgtcca
actgaagagggctgtggggaccggtttaggtgtttttcaggtcagtgcatcagcaaatcg
ttggtttgcaatggggattctgactgtgaggaagatggtgctgatgaagacagatgcgag
ggtgccgaaagcagaccttcctgtgacactgttaaaccccctcccaacatagaacttacc
ggcaacggttacaatgcacttactggccagtttaggaacagagtcatcaacaccaaaagt
ttcggtggtcagtgcaggaaagtgttcagcggggacggaagagatttctacagactgagt
ggaaatatcctctcttatacctttcaggtcaaaatagataatgattttaactatgaattt
tacaacagcagttggtcttacgtaaagcatacatccacagactatacatcatctagttca
aacaggttcttatttttctcctcctcatcaaatcgacacactcagagttcaagtaccaag
gaaatctacatgaaaaagagttataaactgttggttgttcagaacacggttgaagtggcc
cagtttattaataataatcctgaatttntacaacttgcggagccattctggagggaactc
tcccaccttcccactctgtatgactatagtgcctaccgacggttaattgaccagtatggg
acacattacctgcagtccgggtccttaggaggagaatatagagttctattttatgtggat
tcaggagatgtcaaacacaggggatttggatctgtccaggagaaggcatgttcctcttca
gactttaagtttatttttgtatcatcagcaaatcagagatgtaaggaactggaaaacatt
ttcaagtcaaattcaggaaaccagggcagggtgccttcgaggagagccatctgtcatcgg
tggagccctggctttgtagctgacctagttttcctggacctggataatcctgctnggaac
agacagcgctactcctcctgggccagctctgtaacaggtcttccccaagtcataaacaga
gggtatctgacaccgttgtacgagctggtcaaggaagtgccctgtgcctctgtgaaaaga
ctgtacctgaagcgggctcttgaggagtacttagatgaatttgacccctgccattgccgg
ccttgccagaatggtggcatcgctagtgttgtggggacacagtgccagtgtcactgcaaa
ccatacacatatggtatggcgtgtgagcaaggagtccttgtcggcgatcaagcaggaggg
gttgatggaggctggagctgttggtcctcttggagcccctgtgttcaaggaagaaatnnc
aggagccgagaatgcaataatccccctcccagagcgggtggaaaggcctgtattggataa
acgactgaaagcnagcagtgcgaagaccaggacttggagaacttgcgattacttgagcca
cattgctttcatttgtctttggttccaaaaggattctgcccatcaccccctgccttaaaa
gatggatttgttcaaagtgaaggtaccatgtttcctattggaaaaaacatagtatatgct
tgcaatgaagggtattctcttgtcggagatcctgttgccagatgtggagaagacttacag
tggcttgtgggggaaatgcactgtcaaaaaattgcctgttttctacctggagggatgaat
ggcatgcggagtgacccccagaaacccttctacatggttggtgagaaggtgacccctttc
ctgtgcnacggtggtatgtccttagaaggtccttccaccttcctctgcggctccagcctt
aagtggagtcctgagctgaagagtgcccagtgtgtgcaaaaagtcaccagcactctaaca
ccagcagctcctgcatgtcagccctgggagaaactgaagaactcaaaatgcgtctgcaaa
atgccctatgagtgcggatcctccttggatgtgtgtgcccgagatgagcgaagcaacagg
atactgcctttgaccatctgcaagatgcatgttctccagtgtcagggaagaaattatgct
ctcgttggcaagaacagctgtactctgcctgcctcgactgagaaagcgtgtggtgcatgc
ccaatatggagcaaatgtgatgctcagaacagcaaatgtgtctgcagagaagcgtcggag
tgccagaaagcagggtacagaatctgcgtggaagtgaatggcaaagaggagacaatgtcc
gagtgcgaggctggcatcttaaggtgcagagggcagagcatctccatcacagccataaag
ccctgtgcccaagaagtccagtag

KEGG   Rattus norvegicus (rat): 24237
Entry
24237             CDS       T01003                                 

Symbol
C6
Name
(RefSeq) complement component C6 precursor
  KO
K03995  complement component 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno05020  Prion disease
rno05171  Coronavirus disease - COVID-19
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    24237 (C6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    24237 (C6)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    24237 (C6)
  09164 Neurodegenerative disease
   05020 Prion disease
    24237 (C6)
SSDB
Motif
Pfam: MACPF Sushi TSP_1 TSP1_spondin Ldl_recept_a
Other DBs
NCBI-GeneID: 24237
NCBI-ProteinID: NP_788263
RGD: 2238
Ensembl: ENSRNOG00000024115
UniProt: Q811M5
Position
2
AA seq 934 aa
MTRHLTLCFILLIILIDKSEACFCDHYPWTHWSSCSKSCNSGTQSRQRQIVVNDYYRDNS
CDQLCTKQETRQCNVETCPINCVLGDYGTWSDCDPCIRKQVKVRSVLRPSQFGGQPCTEP
LVTFQPCVPSELCKIEETDCKNKFLCDSGRCIPSKLKCNGENDCGDNSDERNCGRTKPVC
SRTYTPIPSVQLMGAGFHFLAGEPRGDVPDNSFTGGICKSVRSSRTSNPHRVPANLENVN
FEVQTIEDDLKTDFYKDLATIGKNKNEDRSLSGEKKDSFYVPIFYSSKKSENFQRNSGFK
NAIEASHKKDSSFVRIHKVIKVLNFTMKTTDLQLSDVFLKALIHLPLEYNFALYSRIFDD
FGTHYFTSGSLGGKYDLLYQFSRQELQNSGLTEEETRNCVRYETKKRFLFFTKTYKEDRC
TTNRLSEKYKGSFLQGSEKSISLVQGGRSQQAAALAWEKGSSGPEANVFSEWLESVKENP
AVVDYELAPIIDLVRNIPCAVTKRNNLRKALQEYAAKFDPCQCAPCPNNGRPRLSGTECL
CVCQSGTYGENCEKRSPDYKSNAVDGNWGCWSSWSACNAAYRRSRSRECNNPEPQRGGQR
CEGKHWQEEDCTFSIMEKVGQPCISDDEEIKEVDLAEPEADSGCPQPPLPENAFVWNEKK
LYSVGEEVEISCLTGFKAVGYQYFRCLPDRTWRQGDVECQRTECLKPVVQDVLTISPFQS
VYKIGESIELTCPRGFVVAGPSRYTCKGDSWTPPIPNSLSCEKDILTKSKGLCQPGQKQS
GSECVCMSPEEDCSSYSEDLCIFDEGSSQYFTSSACKFLAEKCLNSNQFHFVHAGSCQEG
PQLEWGLERLKLAMKSTKRVPCGYDTCYDWEKCSAHTSNCVCLLPPQCPKDENQLHCVKM
GSSMRGKTVNICTLGAVRCANRKVEILNPGRCLD
NT seq 2805 nt   +upstreamnt  +downstreamnt
atgaccagacatctcaccttgtgtttcattttgctgatcatactgattgacaagagtgaa
gcctgtttctgtgaccactacccatggactcactggtccagctgttctaagtcctgcaat
tctggaacccagagcagacagagacaaatcgtagtgaacgattactatcgggataactca
tgcgatcagctctgtaccaagcaggagaccagacagtgcaacgtggagacatgtcccatc
aactgtgtcctaggagactatggaacatggtcagactgtgacccttgtattagaaaacag
gttaaagttagatctgttctgcgcccaagtcagtttgggggacaaccatgcacagagccc
ctggtgacctttcaaccatgtgtcccatctgagctctgcaaaattgaagagactgattgc
aagaataaattcctctgtgacagtgggcgctgtattcccagcaagttaaaatgcaatgga
gaaaatgactgtggagacaattcagacgaaaggaactgtgggaggacaaagccagtatgc
tcacggacatacactcctatccccagtgtgcagctgatgggcgctgggtttcattttctg
gcaggagagcccagaggagatgtccctgataactccttcactggaggaatatgtaaatcc
gtcaggagcagccgaacgagtaatccacaccgagttccagccaatctggaaaatgtcaac
tttgaggtacaaactatagaagatgacttgaaaacagatttctacaaggatttagccact
attggaaaaaataaaaatgaagaccgttcattgtctggtgagaagaaagactctttctac
gtaccaattttttattcctcaaagaaaagtgaaaatttccaacgtaactcaggcttcaaa
aacgccattgaagcctcccacaagaaggattcgagctttgttaggatccataaagtgata
aaagtcttaaacttcacaatgaaaacgacagacctgcagctctcagacgtcttcctaaaa
gccctcatccacctgcctttagaatacaactttgctttgtacagccggatatttgatgac
tttgggacccactatttcacctcaggctcccttgggggcaagtatgaccttctctaccaa
ttcagccgccaggagctacagaactcaggtttaacagaagaagaaactcgaaactgtgtc
cggtatgaaacaaagaaacgtttcttattttttacgaaaacatacaaggaagaccggtgt
accacaaataggctgtctgaaaagtacaaaggttcctttttacagggatcggagaaatct
atatccctggtccagggcgggaggagtcagcaggcagcagccttggcttgggagaagggc
agctctggtccagaggcgaatgtcttctctgagtggttagagtcggtgaaggaaaaccct
gctgtggttgattatgagcttgctccgatcatcgacttggtcagaaacatcccatgtgca
gtgacaaaacggaacaacctcaggaaagcccttcaagaatatgcagccaagtttgaccct
tgccaatgtgctccatgtcctaataatggccgccccaggctctcaggcacagaatgtttg
tgtgtgtgccagagtggtacctacggtgagaactgtgaaaaacggtccccagattataaa
tcgaatgcagtggatgggaactggggctgctggtcttcctggagcgcatgcaatgctgct
tataggaggtcaaggagccgggagtgtaataaccctgagccacagcgaggagggcagcgc
tgtgagggcaagcattggcaagaagaagactgtacattctcaataatggaaaaagttgga
caaccgtgcatcagtgatgatgaagaaataaaagaagtagaccttgctgagccagaagca
gattcagggtgtcctcagccacctctcccagaaaatgcatttgtctggaatgaaaagaaa
ctgtactcagtcggggaggaagttgaaatttcatgtctcactggattcaaagctgtggga
taccagtacttcagatgcttaccagacagaacctggaggcaaggggatgtcgaatgccaa
cggaccgagtgcctcaaaccagtcgttcaggatgtcctgaccatctccccatttcagagt
gtgtacaagattggggaatccattgagctgacctgtcccagaggctttgttgttgctggc
ccatcgaggtatacatgcaagggagactcctggacacctcccattccaaattcactgagc
tgtgaaaaagatattctgacaaagtcaaagggcctttgtcaaccaggacaaaagcaatca
ggatccgagtgtgtttgtatgtccccagaagaagactgtagcagttattcggaagatctc
tgtatatttgatgagggatccagtcagtacttcacttcatctgcttgcaaatttttggct
gaaaaatgtttaaacagcaaccagttccactttgtccatgctggttcctgccaagaaggc
ccacagttagaatggggtcttgagaggctaaaactcgcaatgaagagcacaaagagagtg
ccctgtggatatgatacttgctatgactgggaaaaatgttcagcccacacctccaactgt
gtctgcctattgcccccacaatgccccaaggatgaaaaccaactccactgtgtcaaaatg
ggatcatcaatgcgtgggaaaacagtaaacatctgtacactgggagccgtgaggtgtgca
aacaggaaggtggaaatactgaatcctgggaggtgcttggattag

KEGG   Rattus norvegicus (rat): 296545
Entry
296545            CDS       T01003                                 

Symbol
C8g
Name
(RefSeq) complement component C8 gamma chain
  KO
K03999  complement component 8 subunit gamma
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno05020  Prion disease
rno05146  Amoebiasis
rno05171  Coronavirus disease - COVID-19
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    296545 (C8g)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    296545 (C8g)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    296545 (C8g)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    296545 (C8g)
  09164 Neurodegenerative disease
   05020 Prion disease
    296545 (C8g)
SSDB
Motif
Pfam: Lipocalin
Other DBs
NCBI-GeneID: 296545
NCBI-ProteinID: NP_001100025
RGD: 1309074
Ensembl: ENSRNOG00000028701
UniProt: D3ZPI8
Position
3
AA seq 164 aa
MLQGPERHFAGTWLLVAVGSACRFLQEQGHRAEATTLHIAPQGAAMAASTFRKLDGICWQ
VRQLYGITGVPGRFLLQAPRARGPVHVVVAETDYQSFAILYLEQARRLSVKLYTRTLPVS
DSALNAFEERVRGANLTEDQIFFFPKYGFCETADQFHILNEMPK
NT seq 495 nt   +upstreamnt  +downstreamnt
atgctccagggcccagagagacattttgcagggacatggctccttgtggctgtgggctct
gcatgccgctttcttcaggagcagggacaccgggctgaggccactacattgcacatagct
ccccagggtgcagctatggctgccagcaccttccgaaagctagacgggatctgctggcag
gtgcgccaactctatggaatcacaggggtccctggccgcttcttgctccaagctccacgg
gcccgtgggccagtacatgtggttgttgctgagaccgactaccagagctttgccatcctg
tatctggagcaggcgaggaggctgtctgtgaaactatacacccgcacactgcctgtgagt
gattctgccctgaatgcgtttgaggagcgagtcaggggagccaacctgacagaagaccag
atctttttctttcccaagtatggtttctgtgagactgcagaccaattccacatcctgaat
gagatgccgaagtga

KEGG   Rattus norvegicus (rat): 298288
Entry
298288            CDS       T01003                                 

Symbol
C8a
Name
(RefSeq) complement component C8 alpha chain precursor
  KO
K03997  complement component 8 subunit alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno05020  Prion disease
rno05146  Amoebiasis
rno05171  Coronavirus disease - COVID-19
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    298288 (C8a)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    298288 (C8a)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    298288 (C8a)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    298288 (C8a)
  09164 Neurodegenerative disease
   05020 Prion disease
    298288 (C8a)
SSDB
Motif
Pfam: MACPF Ldl_recept_a TSP_1 TSP1_spondin Cofilin_ADF
Other DBs
NCBI-GeneID: 298288
NCBI-ProteinID: NP_001100140
RGD: 1308355
Ensembl: ENSRNOG00000007697
UniProt: D3ZWD6
Position
5
AA seq 587 aa
MFTVAFFGLSLMAWHSGVTAQEKVNQRVTRAVTPGAVACQLSDWSEWTDCFPCQNEKYRY
RSLLQPSKFGGTICSGDIWDKANCDSPTPCLRQAQCGQDFQCRETGRCLKRHLVCNGDQD
CLDGSDEDNCDDARVIEDDCRQYEPIPGSERAALGYNILTQEEGQSVYDAKYYGGQCETV
YNGDWRRLQYDPTCERLYYGEDEKYFRKPYNFLKYHFEALADTLISSEFYDDANDLFSKI
QRDKSQSNSVTFGISPAKSPITLDASVSWSDESSFMKELSKYNEKKYSFMRVSTKVQTAH
FKMRRHNIVLDEGMMESLMELPEQFNYGMYSKFINDYGTHYITSGTMGGIYEYVLVLDKE
KMRIHGITVEDVKKCIGGGVGLQFGEKIIGEGDLSGESCVMTGDGNQDKRKKDLAVEDII
SRVQGGSSRWSTGLAHNSSAITYRSWGRSLKYNPVVIDFEMQPIYQLLQHTNLGPLETKR
RNLRRALDQYLMEFNACRCGPCFNNGVPILEGTSCSCQCSMGRQGPACESMVLEAMEGAK
ADGRWSCWSSWSECRGGSRERRRQCNNPAPQNGGAPCLGKSLQTQAC
NT seq 1764 nt   +upstreamnt  +downstreamnt
atgtttacagttgctttctttggtttgtctctgatggcatggcactccggggtaactgca
caagagaaggtgaaccagcgggtcacccgagctgtgaccccaggagcggttgcctgtcag
ttgagtgactggtcagaatggacagattgttttccatgtcagaacgaaaagtaccgatac
cggagcctcttgcagccaagcaagtttggaggaaccatctgcagtggtgatatatgggat
aaggccaactgtgacagccccacaccttgtctaaggcaagcacagtgtggacaggatttc
cagtgtagagagacaggtcgctgcctgaaacgccacctggtatgcaatggagatcaggac
tgccttgatggctctgatgaggataactgtgatgatgccagggtcattgaagatgattgc
cgtcagtatgaaccaatcccaggatcagaaagggcagccttggggtacaatatcctgact
caagaagaaggccagagtgtgtatgatgctaagtattatggaggccagtgtgaaactgtg
tacaatggagactggagaaggctgcagtacgaccccacctgtgagcgcctctactatggg
gaggatgagaaatacttccggaagccctacaacttccttaagtaccactttgaagccctg
gcggatactttaatctcttcagagttttatgatgatgcaaatgaccttttttctaagata
cagagggacaaatcccagtcaaatagtgtaacatttggcataagcccagcaaaaagtcct
atcacactagacgcgtccgtatcctggtccgatgaatcttccttcatgaaggagttaagc
aagtataatgagaagaaatatagcttcatgagagtgtccacgaaggtacagacggcacat
tttaagatgaggaggcacaatattgtgctggatgaagggatgatggagtcactgatggag
ctcccagagcagtttaactacggcatgtactccaagttcatcaatgactatggcacccac
tacatcacctctggaaccatgggtggcatttacgaatatgttctggtgcttgacaaagag
aaaatgagaattcatggcattactgtggaagatgtcaaaaaatgcatcggaggtggcgtt
ggcctgcagtttggagagaaaataattggtgaaggagatttatcaggagagtcttgtgtc
atgactggagatggcaaccaggacaaaaggaagaaggacttggcagtggaggacatcatt
tctcgggtacaaggtggaagttctcgctggagcactggcttggcacacaacagcagtgct
attacataccggtcttgggggagatcattaaagtataaccctgttgttatcgattttgag
atgcagcccatctatcagctactgcagcacacaaacctggggcctctggagactaaacgt
cggaacctgcgcagggctttggaccagtacctgatggaatttaatgcctgccgctgtggg
ccctgcttcaacaatggggtacccatactcgagggcaccagctgctcgtgtcaatgtagc
atgggccggcagggccctgcctgtgagagcatggtattggaagcgatggagggagccaaa
gctgatggtcgttggagctgctggagttcctggtcagagtgtagaggagggtcccgggag
aggaggagacagtgcaacaatccagcaccccagaatggaggtgccccatgcctagggaag
agcctgcagacccaggcctgctga

KEGG   Rattus norvegicus (rat): 313421
Entry
313421            CDS       T01003                                 

Symbol
C8b
Name
(RefSeq) complement component C8 beta chain precursor
  KO
K03998  complement component 8 subunit beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno05020  Prion disease
rno05146  Amoebiasis
rno05171  Coronavirus disease - COVID-19
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    313421 (C8b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    313421 (C8b)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    313421 (C8b)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    313421 (C8b)
  09164 Neurodegenerative disease
   05020 Prion disease
    313421 (C8b)
SSDB
Motif
Pfam: MACPF Ldl_recept_a TSP_1 TSP1_spondin
Other DBs
NCBI-GeneID: 313421
NCBI-ProteinID: NP_001178688
RGD: 2239
Ensembl: ENSRNOG00000007639
UniProt: P55314
Position
5
AA seq 589 aa
MKTGAQVWRALAKSCLLCAALGCLHLPGARGEKPDFFETNAVNGSLVRSRPVRSVDVTPA
PTDCQLSTWSSWTACDPCQKKRYRHTYLLRPSQFYGELCDFSDKEVEDCVTNRACRSQVR
CEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRRIYKKCSQDMEQYWAIGNLASGINL
FTNTFEGPVLDHRYYAGACSPHYILNTNFRKPYNVESYTPQTQGKYEFALTEYESYFDFE
HNVTEKATSKSSFKFGFKLDGLVEFGVRKESNEGRHYISRTKRFSHTKSKFLHARSVLEV
AHYKLKSRQLMLHYEFLQRVKSLPLEYSYGEYRDLLRDFGTHFITEAVLGGIYEYTLIMN
KDAMERGDYTLDHVSACAGGGFQIGGNVYKVYLKLGVSEKKCSDILNEIKDRNKRRTMVE
DLVVLVRGGTSEYITSLAYKDLPTAELMKEWGDAVQYNPAIIKLKAEPLYELVTATDFAY
SSTVKQNMKKALEEFQMEVSSCRCAPCRNNGVPILKESRCECICPAGFQGVACEVTNRKD
IPIDGKWSCWSDWSPCSGGRKTRQRQCNNPAPQRGGSPCSGPASETLDC
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgaagacaggggcccaggtttggagggcactggcaaagtcatgtcttctttgtgctgcc
cttggatgtctccatctccctggtgcaagaggtgagaagccagatttctttgagacaaat
gcagtcaatggaagccttgttaggagcagaccagtacggagtgtggatgtcaccccagca
cctactgactgtcaactatccacctggtcctcctggactgcatgtgacccctgtcagaag
aaaaggtacagacacacttacttgctccggccctctcagttctatggggaactgtgtgac
ttctccgacaaggaagttgaagactgtgttaccaaccgagcctgcagaagtcaagtacga
tgtgaaggctttgtgtgtgcacagacagggaggtgtgtgaatcgcagactcctctgcaat
ggagacaatgactgtggagaccaatcagatgaagccaactgtaggaggatttataaaaaa
tgctcacaggatatggaacagtactgggcaattggcaatctggccagcgggataaatctg
ttcacgaacacttttgagggcccagttctcgatcaccggtattatgctggcgcttgctcc
ccccactacatcctgaacaccaattttaggaagccatacaacgtagagagctacacccca
cagacccaaggcaaatatgaatttgcacttacagaatatgaatcctatttcgattttgaa
cataatgtgacagaaaaagcaaccagcaagtctagtttcaagtttggttttaaactggat
ggcctggttgagtttggagtgagaaaagaaagcaacgagggcagacattacattagcaga
accaaacggttctcccacactaaaagcaagtttctgcacgcgcgctctgtccttgaagtg
gcgcattacaagctgaagtccagacagctcatgctccattacgaattccttcagagggtc
aagagcctgcccctggagtacagctatggagaataccgagatctccttcgtgactttggg
acccatttcatcaccgaagccgtgcttgggggcatctacgagtacacgcttatcatgaac
aaagacgccatggagcgaggagattacactctggaccatgtttcagcctgtgccggagga
ggtttccagattggtggtaacgtctataaagtctacctcaaattgggtgtgtccgaaaag
aaatgcagtgacattctgaatgaaatcaaagacagaaataagagacgcaccatggtagaa
gacttggtagttcttgtgcgaggagggacaagtgagtacatcacctccttggcatacaag
gatctgccaacagcagagctgatgaaggaatggggcgatgctgtgcagtacaacccagcc
atcatcaagctcaaggctgagcccctgtatgaacttgtgacagccacagactttgcgtac
tccagcacagtgaaacagaacatgaagaaggccctagaagaattccagatggaggtcagc
tcctgccgctgtgctccgtgcaggaacaatggagtccccatcctgaaagaatcccgctgt
gagtgcatctgtcctgctggcttccaaggtgtagcctgtgaggtcaccaatcggaaagat
atccccatagatgggaagtggagttgctggtctgactggtctccatgctctggaggacgc
aaaacaagacaaaggcagtgcaacaacccggcacctcagagaggaggcagcccctgctca
ggtcctgcttcagaaacactcgactgttaa

KEGG   Rattus norvegicus (rat): 362119
Entry
362119            CDS       T01003                                 

Symbol
C5
Name
(RefSeq) complement C5 precursor
  KO
K03994  complement component 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04610  Complement and coagulation cascades
rno04613  Neutrophil extracellular trap formation
rno04936  Alcoholic liver disease
rno05020  Prion disease
rno05133  Pertussis
rno05150  Staphylococcus aureus infection
rno05168  Herpes simplex virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    362119 (C5)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    362119 (C5)
   04613 Neutrophil extracellular trap formation
    362119 (C5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    362119 (C5)
   05168 Herpes simplex virus 1 infection
    362119 (C5)
  09171 Infectious disease: bacterial
   05133 Pertussis
    362119 (C5)
   05150 Staphylococcus aureus infection
    362119 (C5)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    362119 (C5)
  09164 Neurodegenerative disease
   05020 Prion disease
    362119 (C5)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    362119 (C5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    362119 (C5)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   362119 (C5)
SSDB
Motif
Pfam: TED_complement MG4 MG1 A2M_BRD NTR A2M A2M_recep MG2 MG3 ANATO
Other DBs
NCBI-GeneID: 362119
NCBI-ProteinID: NP_444179
RGD: 2237
Ensembl: ENSRNOG00000018899
Vega: OTTRNOG00000002314
Position
3
AA seq 1688 aa
MPLPAMGLWGLLCLLIFLDKTWGQEQTYVISAPKIFRVGSSENVVIQAHGYTEAFDATIS
LKSYPDKKVTYSSGYVNLSPENKFQNSALLTLPPKQFPRDENPVSHVYLEVVSMHFSKSK
KIPITYDNGFLFIHTDKPVYTPDQSVKIRVYSLSDDLKPAKRETVLTFVDPEGTEVDIVE
ENDYTGIISFPDFKIPSNPKYGVWTIKAKYKKDFTTTGTAYFEVKEYVLPRFSVSIEPES
NFIGYKNFKNFEITVKARYFYNKMVPDAEVYIFFGLREDIKEDEKQMMHKAMQAATLVNG
VAQISFDSETAVKELSYESLEDLNNKYLYIAVTVTESSGGFSEEAEIPGIKYVLSPYTLN
LVATPLFLKPGIPFSIKVQVKDSLEQLVGGVPVTLMAQTVNVNQETSDLEPKRSITHSAD
GVASFVVNLPSEVTSLKFEVKTDAPELPEENQASKEYEAVTYSSLSQSYIYIGWTENYKP
MLVGEYLNIIVTPKSPYIDKITHYNYLILSKGKIVQYGTKEKLLYSSYQNINIPVTQDMV
PSARLLVYYIVTGEQTAELVADAVWINIEEKCGNQLQVHLSPDKDVYSPGQTVSLDMVTE
ADSWVALSAVDSAVYGVRGKAKRAMQRVFQAFDDKSDLGCGAGGGRDNVDVFHLAGLTFL
TNANADDSQYHDDSCKEILRPKRDLQLLHQKVEEQAAKYKHRVPKKCCYDGARENKYETC
EQRVARVTIGPHCIRAFNECCTIADKIRKESHHKGMLLGRIQIKALLPVMKAEIRSYFPE
SWLWEVHRVPKRNQLQVALPDSLTTWEIQGIGISDNGICVADTLKAKVFKDVFLEMNIPY
SVVRGEQIQLKGTVYNYRTSGTMFCVKMSAVEGICTPGSSAASPQTSRSSRCVRQRIEGS
SSHLVTFSLLPLEIGLHSINFSLETSFGKEILVKTLRVVPEGIKRESYAGVTLDPRGVYG
IVNRRKEFPYRIPLDLVPKTNVKRILSVKGLLIGEFLSTVLSKEGIDILTHLPKGSAEAE
LMSIVPVFYVFHYLEAGNHWNIFHPDTLARKQSLQKKIKEGLVSVMSYRNADYSYSMWKG
ASSSAWLTAFALRVLGQVNKYVKQDQYSICNSLLWLIEKCQLENGSFKENSQYLPIKLQG
TLPAEAQENTLYLTAFSVIGIRKAIGICPTEKIYTALAKADSFLLERTLPSKSTFTLAIV
AYALSLGDRTHPKFRSIVSALKREALVKGDPPIYRFWRDTLQRPDSSAPNSGTAGMVETT
AYALLTSLNLKETSYVNPIIKWLSEEQRYGGGFYSTQDTINAIEGLTEYSLLVKQLHLDM
DINVSYKHKGDFYQYKVTEKNFLGRPVEVPLNDDLIVTTGYSSGLATVYVKTVVHKTSVA
EEFCSFYLKIDTQEVEASSYLSYSDSGHKRIIACASYKPSKEESASGSSHAVMDILLPTG
IGANQEDLRALVEGVDQLLTDYQIKDSHVILQLNSIPSRDFLCVRFRIFELFQVGFLNPA
TFTVYEYHRPDKQCTMIYSTSDTNLQRVCEGAACKCVEADCGQLQAELDLAISADTRKET
ACKPEIAYAYKVRITSATEENIFVKYTATLLDIYKTGEAAAEKDSEITFIKKISCTNANL
VKGKQYLIMGKEALQIKHNFSFKYIYPLDSSTWIEYWPTDTTCPSCQAFVANLDEFAEDI
FLNGCENA
NT seq 5067 nt   +upstreamnt  +downstreamnt
atgccgcttccagccatgggcctttggggactactttgccttttaattttcctggacaag
acctggggacaggaacaaacctacgtcatttcagcacccaaaatcttccgggtcggatca
tccgaaaatgtcgtaattcaagcccatggctacaccgaagcctttgacgcaacgatctct
ctgaaaagctatcctgacaaaaaagtgacctactcttccggctatgttaacttgtcgccg
gaaaacaaattccagaactcagcactgttgacattaccgcccaaacaatttcccagagat
gaaaacccagtctctcacgtgtatctggaagttgtgtcaatgcacttttcgaaatcgaag
aaaataccaataacctatgacaatggatttctcttcatccatacagacaaacctgtttac
actccagaccagtcagtaaagattagagtctactctctgagtgacgacttgaagccagcc
aaacgggagactgtcttaactttcgtagatcccgaaggaacagaagttgacatcgtagaa
gaaaatgattatactggaattatctcttttcctgacttcaagattccatctaatcccaag
tatggtgtatggacaattaaagctaaatataagaaggattttacaacgactggaactgca
tactttgaagttaaagaatatgtcttgccccgattctctgtatcaatagaaccagaaagc
aacttcattggctataagaactttaagaactttgaaatcactgtgaaagcaagatatttt
tataataaaatggtccccgatgctgaagtctatatcttttttgggttgagagaggacata
aaagaggatgagaaacagatgatgcataaagccatgcaagccgcaacgttggtcaatgga
gttgctcagatctcttttgactctgaaacagcagtgaaagagctgtcatatgaaagtcta
gaagatctaaacaataagtacctttatattgctgtaacagtcacagagtcttcaggtggg
ttttcggaagaggcagaaattcctggcatcaaatacgtcctctctccctatacactgaat
ttggtcgctacccctcttttcctgaagcctgggattccattttccatcaaggtacaggtt
aaggattcactcgagcagttggtaggaggggtcccagtaactctgatggcacaaacagtc
aatgtgaatcaagagacatctgacttggaaccaaagaggagcatcacacactctgctgat
ggagtggcttcatttgtggtgaacctcccatcagaagtgacatcactgaagtttgaggtc
aaaactgatgccccggaacttcccgaagaaaatcaagccagcaaagaatatgaagcagtt
acatactcatccctcagccagagttacatttacattggctggactgaaaactacaagccc
atgcttgtgggagaatatctgaatattatcgtcacccccaagagtccatatattgacaaa
ataactcactataattacttgattttatccaaaggcaaaattgtacagtatggcacaaag
gagaaacttctctattcatcttatcaaaatataaacatcccagtgacacaggacatggtt
ccttcagcgcggctcctggtctattacatagtcacgggggagcagacagcagaattggtg
gctgacgcagtctggataaacattgaggagaagtgtggcaaccagctccaggtccatctg
tctccagataaagacgtgtattctccaggccaaactgtgtcccttgacatggtgactgaa
gcagactcatgggtggcactatctgcggtggacagcgctgtgtatggagtccggggaaaa
gccaaaagggccatgcaaagagtgttccaagcttttgatgacaagagtgacctgggctgt
ggggcaggtggtggccgtgacaatgtagatgtattccatctagctgggctcaccttcctc
accaatgcaaacgcagatgactcccaataccacgatgactcttgtaaggaaattctcagg
ccaaagagagacctgcagctcctgcatcagaaagtggaagaacaagctgctaaatacaaa
caccgtgtgcccaagaaatgctgttatgatggagcccgagaaaacaaatacgaaacctgt
gagcagcgagttgcccgggtgaccataggcccacactgcatcagggccttcaacgagtgt
tgtactattgcggataagatccgaaaagaaagccaccacaaaggcatgctgttgggaagg
atccaaataaaggccctgttaccagtgatgaaggcagaaatccgaagctactttccagag
agctggctatgggaagttcatcgtgttcccaaaagaaaccagctgcaggttgcactgcct
gactcactgacgacctgggaaattcaaggcatcggcatctcagacaatggtatatgtgtt
gctgacacactcaaggcaaaggtgttcaaagatgtcttcctggagatgaacataccatat
tctgttgtacgaggggagcagatccaattgaagggaaccgtttacaattataggacctct
gggacaatgttctgtgttaaaatgtctgccgtggagggaatctgcactccaggaagctcg
gctgctagccctcagacctctaggtcctccagatgtgtgcgccagagaatagagggctcc
tccagtcacttggtgaccttcagcctgcttcctctggaaattggccttcactccataaac
ttctcactagagacttcatttgggaaagaaatcttagtgaagacattacgggtagtgcca
gaagggatcaaaagggaaagctatgctggtgtgactctggaccccaggggagtttatggt
attgttaacagacgaaaggaattcccatacaggataccattagatttggtccccaaaacc
aacgtcaaaaggattttgagtgtaaaaggactgcttataggggaattcttgtccacggtt
ctgagtaaagaaggcatcgacatcctaacccacctccccaagggcagcgccgaggcagaa
ctcatgagcatagtcccggtgttctacgttttccactacctggaagcaggaaaccattgg
aatattttccaccctgatacgttagctagaaaacagagcctgcagaaaaaaataaaagaa
gggctggtgagcgtcatgtcctacagaaacgctgactattcctacagcatgtggaaggga
gcaagctctagtgcctggctgacagcttttgctctgagagtgcttggacaggtgaacaag
tatgtgaaacaagaccaatactcgatctgtaactccttgttatggctgattgagaagtgt
cagctggaaaacggatctttcaaggaaaattcccaatatctaccaataaaattacagggt
actttgcctgctgaagcccaagagaacactttatatcttacagccttttctgtgattgga
attagaaaggctattggcatatgccccacggagaaaatctacacagcgctggctaaagct
gactccttcctacttgaaaggaccctgccttccaagagcaccttcaccctggccattgtg
gcctatgctctctccctgggagacagaacccacccgaagtttcgttctattgtgtcagcc
ctgaagagggaagctttggttaaaggagacccgcccatttaccgtttctggagagacact
ctccaacgtccagacagctcagcacccaacagcggcacagcaggtatggtagaaaccacg
gcctatgctttgctcaccagcctgaacctgaaggagacgagttatgtcaacccgatcatc
aagtggctatctgaggagcagaggtatggaggcggcttttattccacccaggataccatt
aacgccatcgagggcctgacagagtattcactcctggttaaacaacttcatttggatatg
gatatcaatgtctcctacaaacacaaaggggatttctaccagtataaagtgacagagaag
aacttcctcgggaggccagtggaggtacccctcaatgatgacctcatcgtcaccacaggc
tatagcagtggcttggctacagtatatgtaaaaactgtggttcacaaaactagtgtcgct
gaggaattttgcagcttttacttgaaaattgatacccaagaagttgaagcctccagctac
ctcagctacagtgactcgggacacaagcgcataatagcctgtgccagctacaagcccagc
aaggaggagtcagcatctgggtcctcccatgcagtaatggatatactgctgccgaccgga
atcggagcaaaccaagaagatttacgagctcttgtggaaggagtagatcaactcctaact
gattaccagatcaaagacagtcatgttattctgcaattgaattcgattccctccagagat
ttcctttgtgttcggttccggatatttgaacttttccaagttgggtttctgaatcctgct
acgttcacggtgtacgagtatcacagaccagataagcagtgtaccatgatttacagcact
tctgacaccaaccttcagagagtctgtgaaggagcggcatgcaaatgcgttgaagctgat
tgtgggcaactgcaggcagaactggacctggccatctctgcagacaccaggaaagaaaca
gcatgtaaaccagagattgcatatgcttataaggtcaggatcacgtcggccacggaagaa
aacatttttgtcaagtacactgcgacgcttctggatatttacaaaacaggggaagccgct
gctgagaaggactctgagatcaccttcattaaaaagataagctgtaccaacgccaacctg
gtgaaaggaaagcaatatttaatcatgggcaaagaggctctgcagatcaaacacaatttc
agtttcaagtatatataccctctagattcctccacctggattgaatattggcccacagac
acaacgtgtccatcctgccaagcgtttgtagctaatttggacgagttcgctgaagacatc
tttctaaatggctgtgaaaatgcctga

DBGET integrated database retrieval system