KEGG   Rattus norvegicus (rat): 140447
Entry
140447            CDS       T01003                                 

Gene name
Slc8a2
Definition
(RefSeq) sodium/calcium exchanger 2 precursor
  KO
K05849  solute carrier family 8 (sodium/calcium exchanger)
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04260  Cardiac muscle contraction
rno04261  Adrenergic signaling in cardiomyocytes
rno04371  Apelin signaling pathway
rno04740  Olfactory transduction
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04974  Protein digestion and absorption
rno04978  Mineral absorption
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    140447 (Slc8a2)
   04020 Calcium signaling pathway
    140447 (Slc8a2)
   04022 cGMP-PKG signaling pathway
    140447 (Slc8a2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    140447 (Slc8a2)
   04261 Adrenergic signaling in cardiomyocytes
    140447 (Slc8a2)
  09154 Digestive system
   04974 Protein digestion and absorption
    140447 (Slc8a2)
   04978 Mineral absorption
    140447 (Slc8a2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    140447 (Slc8a2)
  09157 Sensory system
   04740 Olfactory transduction
    140447 (Slc8a2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    140447 (Slc8a2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    140447 (Slc8a2)
   05414 Dilated cardiomyopathy
    140447 (Slc8a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    140447 (Slc8a2)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    140447 (Slc8a2)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC8: Na+/Ca2+ exchanger
   140447 (Slc8a2)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Others
   140447 (Slc8a2)
SSDB
Motif
Pfam: Calx-beta Na_Ca_ex Na_Ca_ex_C
Other DBs
NCBI-GeneID: 140447
NCBI-ProteinID: NP_511174
RGD: 620194
Ensembl: ENSRNOG00000001492
UniProt: P48768
Position
1
AA seq 921 aa
MAPLALVGVALLLGAPHCLGEATPTPSLPPPPANDSDASPGGCQGSYRCQPGVLLPVWEP
DDPSLGDKAARAVVYFVAMVYMFLGVSIIADRFMASIEVITSKEKEITITKANGETSVGT
VRIWNETVSNLTLMALGSSAPEILLSVIEVCGHNFQAGELGPGTIVGSAAFNMFVVIAVC
VYVIPAGESRKIKHLRVFFVTASWSIFAYVWLYLILAVFSPGVVQVWEALLTLVFFPVCV
VFAWMADKRLLFYKYVYKRYRTDPRSGIIIGAEGDPPKSIELDGTFVGTEVPGELGALGT
GPAEARELDASRREVIQILKDLKQKHPDKDLEQLVGIAKYYALLHQQKSRAFYRIQATRL
MTGAGNVLRRHAADAARRPGANDGAPDDEDDGASRIFFEPSLYHCLENCGSVLLSVACQG
GEGNSTFYVDYRTEDGSAKAGSDYEYSEGTLVFKPGETQKELRIGIIDDDIFEEDEHFFV
RLLNLRVGDAQGMFEPDGGGRPKGRLVAPLLATVTILDDDHAGIFSFQDRLLHVSECMGT
VDVRVVRSSGARGTVRLPYRTVDGTARGGGVHYEDACGELEFGDDETMKTLQVKIVDDEE
YEKKDNFFIELGQPQWLKRGISALLLNQGDGDRKLTAEEEEAQRIAEMGKPVLGENCRLE
VIIEESYDFKNTVDKLIKKTNLALVIGTHSWREQFLEAVTVSAGDEEEDEDGSREERLPS
CFDYVMHFLTVFWKVLFACVPPTEYCHGWACFGVCILVIGLLTALIGDLASHFGCTVGLK
DSVNAVVFVALGTSIPDTFASKVAALQDQCADASIGNVTGSNAVNVFLGLGVAWSVAAVY
WAVQGRPFEVRTGTLAFSVTLFTVFAFVGIAVLLYRRRPHIGGELGGPRGPKLATTALFL
GLWFLYILFASLEAYCHIRGF
NT seq 2766 nt   +upstreamnt  +downstreamnt
atggctcccttggctttggtgggggttgccctccttctgggggcaccccactgcttgggg
gaagctactccgaccccatccctgccacctcccccagctaatgacagcgatgccagccca
ggcggctgccaaggttcctaccgctgccaaccaggggtgctgctgcctgtgtgggaaccc
gacgacccatcactgggggacaaggctgcacgggccgtggtgtactttgtggccatggtc
tacatgttcttgggtgtgtctatcattgctgatcgttttatggcatccattgaggtcatc
acatccaaggagaaagagatcaccatcaccaaggcaaatggggagaccagcgtgggcact
gtacgcatctggaatgaaacggtgtccaaccttacactcatggccctgggctcctcagca
cctgagattctgctgtctgtcatcgaggtctgtggccacaacttccaggcgggtgagcta
ggcccaggcaccatcgtgggcagtgccgccttcaacatgtttgtggtcattgctgtgtgt
gtgtatgtcatcccggctggtgagagccgtaagatcaagcacttaagggtcttcttcgtc
acagcctcttggagcatctttgcctatgtctggctttatctcattctagcagttttctct
ccaggcgtggtccaggtgtgggaggcactgctcacgctggtcttcttcccggtgtgtgtg
gtgttcgcctggatggcggacaagcgactgctcttctacaagtacgtgtacaagcgctat
cgcaccgaccctcgcagcggaatcatcatcggggcagagggagacccgcccaagagcatc
gagctggatggcacattcgtgggcactgaggtcccaggcgagctgggtgcattgggcaca
ggtcccgctgaggcgcgtgagctggacgccagccggcgcgaggtcatccagattcttaag
gacttaaagcagaagcacccggataaggacctggagcagctggtgggcatcgccaagtac
tatgcactgctgcaccagcagaagagccgtgccttctaccgcatccaggccacgcggctg
atgacaggtgcgggcaacgtgctgcgccgacacgctgcggatgctgcccgcaggcctggg
gccaacgatggtgcccccgatgatgaggacgatggtgccagccgcatcttctttgagccc
agcctctaccactgcctggagaactgcgggtcagtgctgctgtcggtggcttgccagggt
ggtgagggcaacagcaccttctacgtggattaccgcacggaggatggctctgcaaaggca
ggctccgattatgagtacagcgagggcacgctggtgttcaagcccggggagacgcagaag
gagctgcgcatcggcatcatcgacgacgacatcttcgaggaggacgagcacttcttcgtg
aggctgctgaacctgcgtgtgggcgatgctcagggcatgttcgagcccgacggcggtggg
cggcccaaggggcggctggtggcgccactgctggccaccgtcaccattctggacgacgac
cacgcgggcatcttctccttccaggaccgcctgctgcatgtgagcgagtgcatgggcacc
gtggatgtgcgtgtggtgcgcagctctggcgcacgtggcaccgtacgccttccctaccgc
acagtggacggcacggctcgtggtggtggtgtgcactacgaggatgcttgtggagagctg
gagttcggcgatgacgagaccatgaagactcttcaggtcaagatagtggacgacgaagag
tatgagaagaaggacaacttcttcatcgagctgggccagccccagtggcttaagcggggc
atctcagctctgctactcaaccaaggggatggagacaggaagctgactgcagaggaggag
gaggcccagaggatagcagagatgggcaagccagttcttggggagaactgtcgcctcgag
gtcatcatcgaggagtcttatgactttaagaatacggtggataaactcataaagaaaaca
aacctggccttggtgattgggacccactcatggagggagcagtttttagaggcagttaca
gtgagcgcaggggacgaggaggaggatgaggatgggtctcgtgaggagcggctgccatcc
tgctttgactacgtgatgcacttcctgacggtgttctggaaagttctgttcgcctgcgtt
ccacccacggagtactgccatggctgggcctgctttggtgtctgcatcctggtcattggt
ctgctcactgccctcatcggagacctggcctcacactttgggtgcaccgtgggcctcaag
gactcagtcaacgccgtggtcttcgtggctctgggcacctccatccctgacacgtttgcc
agcaaggtggccgcgctgcaggaccagtgcgccgacgcgtccatcggtaacgtgaccggc
tccaatgcggtgaacgtgttcctgggcctgggtgtggcctggtcggtggccgcagtgtac
tgggcggtgcagggtcgccccttcgaggtgcgtacaggcacgctggccttctcggtcaca
ctgttcaccgtcttcgccttcgtgggcatcgcagtgctcttgtaccggcgccggccacac
atcggcggcgagctgggcggcccgcggggacccaagctagccaccaccgctctcttcctg
ggcctctggttcctctacattctcttcgccagcctggaggcttattgccacattcggggc
ttctag

KEGG   Rattus norvegicus (rat): 140448
Entry
140448            CDS       T01003                                 

Gene name
Slc8a3
Definition
(RefSeq) sodium/calcium exchanger 3 precursor
  KO
K05849  solute carrier family 8 (sodium/calcium exchanger)
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04260  Cardiac muscle contraction
rno04261  Adrenergic signaling in cardiomyocytes
rno04371  Apelin signaling pathway
rno04740  Olfactory transduction
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04974  Protein digestion and absorption
rno04978  Mineral absorption
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    140448 (Slc8a3)
   04020 Calcium signaling pathway
    140448 (Slc8a3)
   04022 cGMP-PKG signaling pathway
    140448 (Slc8a3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    140448 (Slc8a3)
   04261 Adrenergic signaling in cardiomyocytes
    140448 (Slc8a3)
  09154 Digestive system
   04974 Protein digestion and absorption
    140448 (Slc8a3)
   04978 Mineral absorption
    140448 (Slc8a3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    140448 (Slc8a3)
  09157 Sensory system
   04740 Olfactory transduction
    140448 (Slc8a3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    140448 (Slc8a3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    140448 (Slc8a3)
   05414 Dilated cardiomyopathy
    140448 (Slc8a3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    140448 (Slc8a3)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    140448 (Slc8a3)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC8: Na+/Ca2+ exchanger
   140448 (Slc8a3)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Others
   140448 (Slc8a3)
SSDB
Motif
Pfam: Calx-beta Na_Ca_ex Na_Ca_ex_C
Other DBs
NCBI-GeneID: 140448
NCBI-ProteinID: NP_511175
RGD: 620197
Ensembl: ENSRNOG00000029871
UniProt: P70549
Position
6
AA seq 927 aa
MAWLRLQPLTSAFLHFGLVTFVLFLNGLRAEAGDLRDVPSAGQNNESCSGSSDCKEGVIL
PIWYPENPSLGDKIARVIVYFVALIYMFLGVSIIADRFMASIEVITSQEREVTIKKPNGE
TSTTTIRVWNETVSNLTLMALGSSAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFI
IIGICVYVIPDGETRKIKHLRVFFVTAAWSVFAYIWLYMILAVFSPGVVQVWEGLLTLFF
FPVCVLLAWVADKRLLFYKYMHKRYRTDKHRGIIIETEGEHPKGIEMDGKMMNSHFLDGN
LIPLEGKEVDESRREMIRILKDLKQKHPEKDLDQLVEMANYYALSHQQKSRAFYRIQATR
MMTGAGNILKKHAAEQAKKTASMSEVHTDEPEDFASKVFFDPCSYQCLENCGAVLLTVVR
KGGDISKTMYVDYKTEDGSANAGADYEFTEGTVVLKPGETQKEFSVGIIDDDIFEEDEHF
FVRLSNVRVEEEQLEEGMTPAILNSLPLPRAVLASPCVATVTILDDDHAGIFTFECDTIH
VSESIGVMEVKVLRTSGARGTVIVPFRTVEGTAKGGGEDFEDTYGELEFKNDETVKTIRV
KIVDEEEYERQENFFIALGEPKWMERGISALLLSPEVTDRKLTMEEEEAKRIAEMGKPVL
GEHPKLEVIIEESYEFKSTVDKLIKKTNLALVVGTHSWRDQFMEAITVSAAGDEEEDESG
EERLPSCFDYVMHFLTVFWKVLFACVPPTEYCHGWACFVVSILIIGMLTAIIGDLASHFG
CTIGLKDSVTAVVFVAFGTSVPDTFASKAAALQDVYADASIGNVTGSNAVNVFLGIGLAW
SVAAIYWAMQGQEFHVSAGTLAFSVTLFTIFAFVCLSVLLYRRRPHLGGELGGPRGCKLA
TTWLFVSLWLLYVLFATLEAYCYIKGF
NT seq 2784 nt   +upstreamnt  +downstreamnt
atggcgtggttacggctgcagcctctcacctctgccttcctccatttcgggctggttact
tttgtgctcttcctgaatggtcttcgagcagaggctggtgacttgagggatgtgcccagt
gcaggacagaacaatgagtcctgttcagggtcatcagactgcaaggagggtgtcatcttg
ccaatctggtatccagagaacccttcccttggggacaagattgcaagggtcattgtctat
tttgtggccctgatatacatgtttcttggagtgtctatcattgctgaccgattcatggca
tctattgaagttattacctcccaagagagggaggtgacaatcaagaagcccaatggagag
accagcacaactacaattcgggtatggaatgaaactgtctccaacctgaccctgatggcc
ctaggctcttctgctccggagattctcctgtctttaattgaggtgtgtggtcacgggttc
attgctggtgatttgggaccgtctaccattgtcggcagtgcagccttcaacatgttcatc
atcattggcatctgtgtctatgtgatcccagatggggagactcgcaagatcaagcacctt
cgagtcttctttgtcacggctgcttggagcgtctttgcctatatttggctctacatgatc
ctggcagtcttctctcctggtgtggtccaggtttgggaaggcctccttactctcttcttc
tttccagtgtgtgtcctgctggcttgggtggcagataagcgactgctcttctacaaatac
atgcacaaaagataccgcacagataaacaccgaggaattatcattgagacagagggtgaa
caccctaagggcattgagatggatgggaaaatgatgaattctcacttcctggatgggaac
cttatacccttggaaggaaaggaggtagatgaatctcgcagggaaatgatccgaattctt
aaggatctgaagcaaaaacacccagaaaaagacttagatcagctggtggagatggccaat
tactatgctctttcccaccaacagaagagccgtgctttctaccgcatccaagccacccgg
atgatgactggtgcaggcaatatacttaagaaacatgcagcagagcaagccaagaagacc
gccagcatgagtgaggtgcatactgatgagcctgaggactttgcctcgaaggtctttttt
gacccatgctcttaccagtgcctggagaactgtggagctgtcctcctgactgtggtgagg
aaagggggagatatatccaagactatgtacgtggactacaaaacagaggacggctctgcc
aatgcaggggctgactatgagttcacagaaggcactgtggttctgaagccaggagagacc
cagaaggagttctccgtgggcatcatcgatgatgacatttttgaagaggatgaacacttc
ttcgtgagactgagcaatgtccgtgtagaagaggagcagctggaagaggggatgaccccc
gccatcctcaatagtcttcctttgccacgggctgtcctggcttccccttgtgtggccaca
gtaaccatcttggatgatgaccatgcaggaattttcacttttgaatgtgataccattcat
gtcagtgaaagtattggtgttatggaagtcaaggttttgaggacatcgggtgcccggggc
acagtcatcgtcccttttaggacagtagaaggaacagccaagggtggtggtgaggacttt
gaagatacttatggggagctggagtttaagaatgatgaaacggtgaaaaccataagggtt
aaaatagtagatgaggaggagtacgaaaggcaagagaatttcttcattgcccttggtgaa
ccgaaatggatggaacgtggaatatcagcgctcctgttatctccagaggtgacagacagg
aagctgactatggaggaagaggaggccaagagaatagcagagatgggaaagccagtattg
ggtgaacaccctaaactagaggtcatcattgaagagtcctatgagttcaagagtacagtg
gataaactgatcaagaagacaaacctggcattggttgtggggacccattcctggagggac
caattcatggaagccatcactgttagtgcagcaggagatgaggaggaagatgaatctgga
gaggagaggctgccatcatgctttgactatgtcatgcacttcctgacggtcttttggaag
gtgctctttgcctgtgtgccccccacagagtactgccatggctgggcctgcttcgtggtc
tccatcctcatcatcggcatgctcaccgccatcatcggggacctggcctctcacttcggc
tgcaccatcgggctcaaggattcggtcacagctgttgtttttgtggcattcggcacctct
gtgccagatacatttgccagcaaagctgctgccctgcaggatgtgtatgcagatgcttct
attggcaatgtcaccggcagtaatgctgtcaatgtcttcctgggtattggtttggcctgg
tccgtcgccgccatctactgggccatgcagggacaggagttccatgtgtccgctggtact
ctggccttctcggtcactcttttcaccatctttgcatttgtctgcctcagtgtgctcttg
taccgtcggcggccccacctgggcggggagcttggaggtcctcgtggctgcaagcttgcc
acaacgtggctctttgtgagcctgtggctcctctacgtactctttgccacgctggaggcc
tactgctacatcaaggggttctga

KEGG   Rattus norvegicus (rat): 29715
Entry
29715             CDS       T01003                                 

Gene name
Slc8a1
Definition
(RefSeq) sodium/calcium exchanger 1 isoform 6 precursor
  KO
K05849  solute carrier family 8 (sodium/calcium exchanger)
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04260  Cardiac muscle contraction
rno04261  Adrenergic signaling in cardiomyocytes
rno04371  Apelin signaling pathway
rno04740  Olfactory transduction
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04974  Protein digestion and absorption
rno04978  Mineral absorption
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    29715 (Slc8a1)
   04020 Calcium signaling pathway
    29715 (Slc8a1)
   04022 cGMP-PKG signaling pathway
    29715 (Slc8a1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    29715 (Slc8a1)
   04261 Adrenergic signaling in cardiomyocytes
    29715 (Slc8a1)
  09154 Digestive system
   04974 Protein digestion and absorption
    29715 (Slc8a1)
   04978 Mineral absorption
    29715 (Slc8a1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    29715 (Slc8a1)
  09157 Sensory system
   04740 Olfactory transduction
    29715 (Slc8a1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    29715 (Slc8a1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    29715 (Slc8a1)
   05414 Dilated cardiomyopathy
    29715 (Slc8a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    29715 (Slc8a1)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    29715 (Slc8a1)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC8: Na+/Ca2+ exchanger
   29715 (Slc8a1)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Others
   29715 (Slc8a1)
SSDB
Motif
Pfam: Na_Ca_ex Calx-beta Na_Ca_ex_C DnaG_DnaB_bind
Other DBs
NCBI-GeneID: 29715
NCBI-ProteinID: NP_001257705
RGD: 3717
Ensembl: ENSRNOG00000008479
UniProt: Q01728
Position
6
AA seq 969 aa
MLRLSLPPNVSMGFRLVTLVALLFTHVDHITADTEAETGGNETTECTGSYYCKKGVILPI
WEPQDPSFGDKIARATVYFVAMVYMFLGVSIIADRFMSSIEVITSQEKEITIKKPNGETT
KTTVRIWNETVSNLTLMALGSSAPEILLSVIEVCGHNFTAGDLGPSTIVGSAAFNMFIII
ALCVYVVPDGETRKIKHLRVFFVTAAWSIFAYTWLYIILSVSSPGVVEVWEGLLTFFFFP
ICVVFAWVADRRLLFYKYVYKRYRAGKQRGMIIEHEGDRPASKTEIEMDGKVVNSHVDNF
LDGALVLEVDERDQDDEEARREMARILKELKQKHPDKEIEQLIELANYQVLSQQQKSRAF
YRIQATRLMTGAGNILKRHAADQARKAVSMHEVNMDVVENDPVSKVFFEQGTYQCLENCG
TVALTIIRRGGDLTNTVFVDFRTEDGTANAGSDYEFTEGTVIFKPGETQKEIRVGIIDDD
IFEEDENFLVHLSNVRVSSEVSEDGILDSNHVSAIACLGSPNTATITIFDDDHAGIFTFE
EPVTHVSESIGIMEVKVLRTSGARGNVIIPYKTIEGTARGGGEDFEDTCGELEFQNDEIV
KIITIRIFDREEYEKECSFSLVLEEPKWIRRGMKALLLNELGGFTLTGKKMYGQPVFRKV
HARDHPIPSTVISISEEYDDKQPLTSKEEEERRIAEMGRPILGEHTKLEVIIEESYEFKS
TVDKLIKKTNLALVVGTNSWREQFIEAITVSAGEDDDDDECGEEKLPSCFDYVMHFLTVF
WKVLFAFVPPTEYWNGWACFIVSILMIGLLTAFIGDLASHFGCTIGLKDSVTAVVFVALG
TSVPDTFASKVAATQDQYADASIGNVTGSNAVNVFLGIGVAWSIAAIYHAANGEQFKVSP
GTLAFSVTLFTIFAFINVGVLLYRRRPEIGGELGGPRTAKLLTSSLFVLLWLLYIFFSSL
EAYCHIKGF
NT seq 2910 nt   +upstreamnt  +downstreamnt
atgcttcgactaagtctcccacccaatgtttcaatgggatttcgtctggtaactctggtg
gctctcttgtttacccatgttgaccatataactgcagatacagaggcagaaacaggagga
aatgaaaccactgaatgtactggctcatattactgtaagaaaggggtgattctgcccatt
tgggaaccccaagacccatcttttggggataaaattgctagagcaactgtgtattttgtg
gccatggtctacatgttcctcggagtttctattattgccgaccggtttatgtcctctata
gaagtcatcacctctcaagaaaaggagattaccataaagaaaccaaatggagagaccacc
aagactacagtgcgtatctggaatgagactgtgtccaacctgaccttgatggccctggga
tcttccgctcctgagattctcctgtctgtcattgaagtgtgtggccataacttcaccgca
ggggaccttggtcccagcaccattgtgggaagcgccgccttcaacatgttcatcatcatc
gcgctttgtgtttatgtggtcccagatggagagacgaggaagattaaacatctgcgtgtg
ttctttgtgacagcagcctggagcatctttgcctatacctggctttacataattttgtct
gtcagctctcctggtgtcgtggaggtctgggaaggattactcactttcttcttctttccc
atctgtgttgtgttcgcttgggttgcagacaggcggcttctcttttacaagtatgtctac
aagcggtacagggctggcaagcagagggggatgatcattgaacatgaaggagacagacca
gcttccaaaactgaaattgaaatggatgggaaagtagtcaactcccacgttgacaatttc
ttagatggcgctctggttttggaagtcgatgagagggaccaagatgacgaggaagccagg
cgtgagatggcaaggattctgaaggaacttaagcagaagcatcccgacaaagagatcgaa
caattaatagaattagccaactatcaagtcctaagtcagcagcaaaagagccgagcattt
taccgaattcaagctactcgcctgatgactggagctggtaacattttgaagaggcatgca
gctgaccaagcgaggaaggctgtcagcatgcatgaagtcaacatggatgtggttgaaaat
gacccagtcagtaaggtcttctttgagcaagggacataccagtgtctagaaaactgtggt
actgtggccctcaccattattcgaagagggggtgacttgaccaacactgtgtttgttgac
ttcaggacggaagatggcacagccaatgctgggtctgattatgagttcacggaagggact
gtgatcttcaaacctggggagacccagaaggaaatcagagttggcatcattgatgatgat
atctttgaagaagatgaaaactttcttgtgcatcttagcaacgtcagggtctcttcagaa
gtctcggaagatggcatactagactccaatcacgtgtctgcgattgcttgtctcgggtca
cccaacactgccaccataaccatttttgatgatgaccacgcgggcatctttactttcgag
gaacccgtgactcacgtgagcgagagcattggcatcatggaggtgaaggtgctgagaacc
tctggagcgcgaggaaatgttatcattccctataaaaccattgaaggcacagcccgaggt
ggaggggaggactttgaggacacctgtggagagctggaattccagaatgatgaaatagtg
aagatcattaccattagaatatttgaccgtgaggaatatgagaaagagtgcagtttctcc
cttgtgcttgaggaaccaaaatggataagaagaggaatgaaagccctgttgttaaatgag
cttggtggcttcacattaacaggaaaaaagatgtatggccaacctgtcttcaggaaggtc
catgctagagatcatccgattccctctaccgtaatcagcatttcagaggagtacgatgac
aagcagccactgaccagcaaagaggaggaggagaggcgcattgcagaaatggggcgcccc
attctaggcgaacacaccaagctggaagtgatcattgaagagtcttacgaattcaagagc
actgtggacaaactcattaagaagacgaacctggccctcgtggtggggaccaacagctgg
agagagcagttcattgaagcgatcaccgtcagcgctggggaagatgacgatgatgatgaa
tgtggggaggagaagctgccctcctgttttgattacgtgatgcactttctcacagtgttc
tggaaggttctgtttgccttcgtcccacctacagaatattggaatggctgggcctgcttc
attgtctccatcctcatgatcggcctactgacagccttcattggagatctggcttcccac
tttggctgcaccattggtctgaaagattccgtgactgcagttgtgtttgtcgctcttgga
acctcagtgccagacacatttgccagcaaagtagcagctacccaggaccagtatgcagat
gcgtccataggcaatgtcaccggaagcaacgctgtgaatgtcttcctgggaatcggcgtg
gcctggtccattgctgccatctaccatgcggccaacggggaacagttcaaagtgtcccct
ggcacgctagctttctctgtcactctcttcaccatttttgctttcatcaacgtgggggtg
ctgctgtatcggcggaggccagaaataggaggtgagctgggtgggccccggactgccaag
ctcctcacatcttccctgtttgtgctcctgtggctcttgtacattttcttctcctccctg
gaggcctactgccacataaaaggcttctaa

DBGET integrated database retrieval system