KEGG   Rattus norvegicus (rat): 140588
Entry
140588            CDS       T01003                                 

Gene name
Gli3
Definition
(RefSeq) transcriptional activator GLI3
  KO
K06230  zinc finger protein GLI3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04340  Hedgehog signaling pathway
rno05200  Pathways in cancer
rno05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    140588 (Gli3)
   04024 cAMP signaling pathway
    140588 (Gli3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    140588 (Gli3)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    140588 (Gli3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    140588 (Gli3)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    140588 (Gli3)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4
Other DBs
NCBI-GeneID: 140588
NCBI-ProteinID: NP_536330
RGD: 620272
Ensembl: ENSRNOG00000014395
Position
17
AA seq 1582 aa
MEAQSHSSTTTERKKAESSIAKCPTRTDVSEKAVASSTTSNEDESAGQIYHRERRNAITM
QPQSVQGLSKISEEPSTSSDERASLIKKEIHGSLPHLAEPSLPYRGTVFAMDPRNGYMEP
HYHPPHLFPAFHPPVPIDARHHEGRYHYDPSPIPPLHVPSALSSSPTYPDLPFIRISPHR
NPTAASESPFSPPHPYINPYMDYIRSLHSSPSLSMISAARGLSPTDAPHAGVSPAEYYHQ
MALLTGQRSPYADILPSAATAGAGAIHMEYLHAMDSTRFPSPRLSARPSRKRTLSISPLS
DHSFDLQTMIRTSPNSLVTILNNSRSSSSASGSYGHLSASAISPALSFTYPSAPVSLHMH
QQILSRQQSLGSAFGHSPPLIHPAPTFPTQRPIPGIPTVLNPVQVSSGPSESSQSKPTSE
SAVSSTGDPMHNKRSKIKPDEDLPSPGSRGQQEQPEGTTLVKEEGDKDESKQEPEVIYET
NCHWEGCTREFDTQDQLVHHINNDHIHGEKKEFVCRWLDCSREQKPFKAQYMLVVHMRRH
TGEKPHKCTFEGCTKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRT
HSNEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPEAHVTKKQRGDMHPRPPPPRDSGSHS
QSRSPGRPTQGAFGEQKELSNTTSKREECLQVKTVKAEKPMTSQPSPGGQSSCSSQQSPI
SNYSNSGLELPLTDGGSIADLSAIDETPIMDSTISTATTALALQGRRNPAGTKWMEHIKL
ERLKQVNGMFPRLNPILPSKAPAVSPLIGNGTQSNNNYSSGGPGTLLPSRSDLSGVDFTV
LNTLNRRDSNTSTISSAYLSSRRSSGISPCFSSRRSSEASQAEGRPQNVSVADSYDPIST
DASRRSSEASQGDGLPSLLSLTPVQQYRLKAKYAAATGGPPPTPLPHMEKLSLKTRMALL
GEGRDSGVTLPPVHPPRRCSDGGGHTYSRRHLLPHDALANSARRASDPVRTVSENMSLPR
VQRFSSLNSFNPPNLPPSVEKRSLVLQNYTRQESTHPRYFQASPCPPSITENVALEALTM
DADASLNDEDFLPDDVVQYLNSQNQTGYGQQLQSSISEDGKVAREPEDLDLPGLPDSHVG
QQYPALEQPCSEGSKTDLPIQWNEVSSGSSDLSSSKLKCGQRPTVQQARGFGLYSNMVVH
PQNLWKVGTGPAGGSQTLGENGSSYSDPEHFAVHSGDGLGPSGDTFHEQAYKTQQYGSQL
SRQPLTSSVLDSACGAGIQGSKLKGNSLQENGGLLDFGLSMAPNELADNIVNGIQTQEQM
GQGYIAPQLLSGSMQHQGPSRPGQQVLGQVGATSHINIYQGTESCLPGTQDKISQPSSMA
VIRGYQPCASYGGSRRQAMPRGSLTLQQGQLSDVSQTSRVNSIKMEAHGQSHQLCSSMQN
YSGQFYDQTMGFSQQDRKAGSFSLSEANCLLQENGSENSELLSPGVNQVTSTVDSFESHD
LEGVQIDFDAIIDDGDHTSLMSGALSPSIIQNLSHSSSRLTTPRASLPFPSLSMSTTNMA
IGDMSSLLTSLAEESKFLAVMQ
NT seq 4749 nt   +upstreamnt  +downstreamnt
atggaggcccagtcccacagctcgacgacaactgagaggaagaaagctgaaagttccatt
gcgaagtgtcccacaagaacagatgtcagtgagaaggccgtggcctccagtaccacttca
aatgaggatgaaagtgctggacagatctatcaccgagagagaagaaacgcaatcactatg
cagcctcagagtgtgcagggtctcagcaaaatcagtgaggagccctcaacatctagtgat
gagagggcctcgttgatcaagaaagagatccatggatctctaccacatctggctgagccc
tctctcccttatcgtgggactgtgtttgccatggatccccggaatggttacatggagcct
cactaccaccctcctcatctttttcctgccttccatcctcctgtaccgattgatgccaga
catcacgagggccgctaccattatgatccatctcctattcctccattacacgtgccttct
gccttatctagtagtccaacgtatccagacttgcctttcattaggatctccccacaccgt
aaccccactgcagcttcagagtcccccttcagccccccacacccctacatcaacccatat
atggactacatccgctccttgcacagcagcccatccctctccatgatctccgctgcccga
gggctgagccccacagatgccccccatgctggagtcagccctgcggaatactatcaccag
atggctctgctgacaggccagcgcagcccctatgcagacatccttccctcagccgccact
gctggtgcaggggccatccatatggagtaccttcatgccatggacagcaccagatttccc
agccctagactgtcagctaggcccagccgaaagcgtaccctgtcgatctctccactgtca
gatcatagcttcgaccttcagaccatgataagaacatctcctaactccttggtcacaatc
ctcaataattcccgtagcagttcttcagcaagtggttcctatgggcacttatctgcaagt
gcaatcagccctgctttgagcttcacctacccctccgcccccgtgtctctccatatgcat
caacagatcctaagccgacagcagagcttaggttcagcatttggacatagccctcccctc
atccaccctgctccaacatttccaacgcagagacccatccctgggattccgacggttctg
aaccctgtccaggtcagctctggcccttctgagtcttcacagagcaaacccacaagtgag
tctgcagtgagtagtaccggtgaccctatgcataataagcggtccaagatcaagcccgat
gaagacctccccagcccaggatcacgggggcagcaggaacagccggagggaacaacccta
gtcaaggaggaaggggacaaagatgaaagcaagcaggagcctgaagtcatctatgagaca
aactgccactgggaaggctgcacaagagagttcgacacccaggatcagcttgtgcatcat
atcaataatgaccacattcatggagaaaagaaggagtttgtgtgccgctggcttgattgt
tcaagagagcagaaaccgttcaaagcccagtacatgttggtagtacatatgagaagacac
accggagagaagcctcacaaatgtacatttgaaggttgtacaaaagcctactcaagactc
gaaaacctgaaaacccacttgagatctcacactggagagaagccatatgtctgtgagcat
gagggctgcaacaaggctttctctaacgcttcagatcgggccaagcaccaaaacagaaca
cattccaatgagaaaccatatgtatgcaaaatccctggctgcaccaagcgttacacagac
cccagctctctccggaaacatgtgaagactgtgcatggccctgaggctcatgttaccaag
aagcagcgtggggacatgcaccctcggcctccaccacctagagattctggcagccattca
cagtccaggtcccccggccggccgactcagggagcattcggtgagcagaaggagctgagc
aacactacctcaaagcgggaagaatgcctccaggtgaagactgtcaaggctgaaaagccc
atgacatctcagccaagccctggtggtcagtcttcatgcagcagccaacagtcccccatc
agcaactattccaacagtgggctcgagcttcctctgactgatggaggtagtatagcagac
ctcagtgccatcgatgagaccccaatcatggactcgaccatttccacggcaaccacagcc
cttgctttgcaaggcaggagaaacccagcagggaccaaatggatggagcatatcaaactt
gaaaggctaaagcaagtgaatggaatgtttccaagactgaaccctattctaccctccaaa
gcccctgcggtatctcctctcataggaaatggcacacagtcaaataacaactacagttca
ggcgggcccgggacccttctcccgagcagaagtgatctgtcgggtgtagacttcactgtg
ctgaacacgctcaacaggagggacagcaacaccagcaccatcagctctgcctacctgagc
agccgcagatcctcgggcatctccccctgcttttccagccgcaggtccagtgaggcatcg
caggctgaagggcgaccccagaatgtgagtgtggccgactcctacgatcccatctccaca
gatgcttcacggaggtccagcgaggccagccagggtgatgggctgcccagtctgctcagc
ctcacacccgtgcagcagtaccgcctgaaggccaagtatgctgctgccacgggtggcccg
ccacccacacctctgccccacatggaaaagctgagcctgaagaccaggatggccctgctc
ggggaggggagggactcaggggtgactctgcctccagtccatcctcctcggagatgcagt
gatggaggaggccatacatacagcaggcgtcacctactgcctcatgatgcgctagcaaac
agtgcgaggagagccagcgaccctgtgaggaccgtctccgagaacatgtcacttcccagg
gttcaacgcttcagcagcctgaatagctttaatcctccaaatttgcctccatccgtggaa
aagcgtagtttagtgctgcaaaattatacccggcaggagagcacccatccccggtacttc
caagcatccccttgccctcccagcatcacagagaatgttgccctggaggccctgaccatg
gatgctgatgctagcttgaatgatgaagatttcctgccagatgatgtggtacagtatttg
aattcccagaaccaaacagggtatgggcagcaattacagagttccatctctgaagatggc
aaagtagcccgtgagccagaggacttggacttaccggggctgccagacagtcatgttggc
cagcaatacccagctctggagcaaccctgctccgagggcagtaaaactgatttgcccatc
cagtggaatgaggtcagctctggaagttctgatctgtcatcctccaagctgaagtgtggt
cagcgccctaccgtacagcaggctcgaggctttgggttatacagcaatatggtggtacat
ccacagaacctgtggaaggttggcactggcccagctgggggatctcagacccttggggag
aatggcagttcctacagtgacccagagcactttgcagtccacagtggggatggacttggc
cccagtggagatactttccatgaacaggcctataagacccagcagtatgggagccagctc
agcaggcagccactgacttccagtgttctagacagtgcctgtggtgctgggattcaaggg
tccaagctgaaaggcaacagtttgcaagagaatgggggtttgctagattttggcctgtcc
atggcaccaaatgagttagctgacaacatagtgaatggcatacaaacccaagaacaaatg
gggcaggggtacattgctcctcagctactcagtggcagcatgcaacaccaggggcccagt
cgccctggtcaacaggtactagggcaggttggtgctacctcacatatcaacatctatcaa
gggacagagagctgcctaccagggactcaggacaagatcagccagccatcaagtatggca
gttatcaggggctaccagccctgtgccagctatgggggcagcaggcgtcaggcaatgcca
aggggcagcctcactctgcaacaaggacagctcagtgacgtgagtcagaccagcagggtg
aacagcatcaaaatggaggcacacgggcagtcccatcagctctgctctagcatgcagaat
tattccggtcagttttatgaccaaaccatgggcttcagtcagcaagacaggaaagctggc
tcattctccctctcagaggccaactgcctgctccaggagaatggctctgaaaattctgag
ttactttccccaggtgttaaccaggtgaccagcacagttgacagctttgagagtcatgac
ctagaaggcgtgcagattgattttgatgccatcatagatgatggggaccataccagccta
atgtcaggggccttgagccccagtatcattcagaacctttcccacagctcctcccgtctc
accacacctcgggcatccctcccattcccttctctgtccatgagcaccaccaacatggct
attggggatatgagttctttgctgacctcccttgcagaagaaagcaagttccttgcagtt
atgcagtag

KEGG   Rattus norvegicus (rat): 140589
Entry
140589            CDS       T01003                                 

Gene name
Gli1
Definition
(RefSeq) zinc finger protein GLI1
  KO
K16797  zinc finger protein GLI1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04340  Hedgehog signaling pathway
rno05200  Pathways in cancer
rno05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    140589 (Gli1)
   04024 cAMP signaling pathway
    140589 (Gli1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    140589 (Gli1)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    140589 (Gli1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    140589 (Gli1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    140589 (Gli1)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4 zf-C2H2_8 IL17
Other DBs
NCBI-GeneID: 140589
NCBI-ProteinID: NP_001178839
RGD: 621673
Ensembl: ENSRNOG00000025120
UniProt: G3V6X8
Position
7
AA seq 1109 aa
MFNPMTSPQVNSYGEPCCLRPLPSQGVPSMGTEGLSGLPFCHQANFMSGSQGYGSARETS
SCTEGSLFPPPRSSVKLTKKRALSISPLSDASLDLQTVIRTSPSSLVAFINSRCTSPGGS
YGHLSIGTMSPSLGFPPQMSHQKGTSPPYGVQPCVPHDSTQGSMMLHPQSRGPRATCQLK
SELDIMVGKCPEEPLEGDMSSPNSTSTQDHLLGMLDGREDLEREEKPEPESVYETDCRWD
GCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTGEKP
HKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEQEGCSKAFSNASDRAKHQNRTHSNEK
PYVCKLPGCTKRYTDPSSLRKHVKTVHGPDAHVTKRHRGDGPLPRAQPLSTVEPKREREG
GSGREESRLTVPEGTMPQQSPGAQSSCSSDHSPAGSAANTDSGVEMAGNAGGSTEDLSSL
DEGPCVAATGLSTLRRLENLRLDQLHQLRPIGSRGLKLPSLTHAGAPVSRRLGPPVSLDR
RSSSSSSISSAYTVSRRSSLASPFPPGSPPENGASSLPGLTPAQHYMLRARYASARGSGT
PPTAAHSLDRIGGLPAPPWRSRAEYPGYNPNAGVTRRASDPARAADHPAPARVQRFKSLG
CVHTPPSVATGRNFDPHLPTSVYSPQPPSITENVAMDTRGLQGELEVGTSMMGNDLNPYM
DFSSADTLGYGGPEGTAAESYGSKGPGSLPLGPGPPTNYGPGHCAQQVSYPDPTPETWGE
FPSHAGVYPGTKALGTAYNQCPRLEHYGQVQVKPEQGCPVGSDSTGLAPCLNAHPSEGSP
DPQPLFSHHSQLPPPQYLQSGPYPQPPHDCLSLESRPGLNFNPSSHSTGQLKAQLLCNYV
QSQQELLWEGRSRGGIPNQELPYQSPKFLGGSQVSQSPTKVPAAAAAATFGSGFASPALA
NHKSVSYPAPSPCHETFTMGVNRPPHRPAAPPRLLPPLPPCYGPLKVGDANPSCGHPEVG
RLGAGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEAQGLSPPPSHEQGDSSKNTPPP
SGPPNMAVGNMSVLLGSLPGETQFLNSSA
NT seq 3330 nt   +upstreamnt  +downstreamnt
atgttcaatccaatgacttcaccacaagtcaatagctatggtgagccatgctgtctccga
cccctccccagccaaggggtccccagcatgggaacagaaggactttctggtctgcccttt
tgccaccaagccaattttatgtcagggtcccagggttatgggtctgccagagagaccagc
agctgcactgaggggtcactctttcctcctcctcggagttcagtcaaactgactaagaag
cgggctctttccatctcgcctctctctgacgccagcctcgacctgcaaaccgtaatccgt
acctcacccagctccctcgtggctttcatcaactctcgttgtacatctccaggcggttcc
tacggccatctctccattggcaccatgagcccttctttaggattcccacctcagatgagt
caccagaaaggaacttcacctccctatggagtccagccctgtgttccacatgattctact
cagggttcaatgatgcttcacccccagtcccgaggaccacgtgcaacctgccagctgaag
tcagagctggacatcatggttggcaagtgcccagaggaacctttggaaggggacatgtct
agccccaactccacgagcacacaggatcacctgctggggatgctggatggacgggaggac
ctggagagagaggagaaacctgagcctgagtctgtgtatgagacggactgccgctgggat
ggttgcagccaggagttcgattcccaagaacagctggtgcaccacatcaacagtgagcac
atccacggggagcggaaggagttcgtgtgccactggggaggctgctccagggagctgagg
cccttcaaggcccagtacatgctggtggtgcacatgcgcagacacacgggcgagaagcca
cacaagtgcacgtttgaaggctgtcggaagtcctattcacgcctcgaaaacctgaagaca
caccttcggtcgcacaccggtgagaagccttatatgtgtgagcaggaaggctgcagcaag
gccttcagcaacgccagtgaccgtgccaagcaccagaataggacccactccaatgagaag
ccatatgtgtgcaaactccccggctgcaccaagcgctacacagatcccagctcgctccgc
aaacatgtcaagactgtgcacggtccggatgcccacgtgaccaaacgacatcgaggggat
ggccccttaccacgggcacagcccctctccacagtggagcccaagcgagaaagggaagga
ggatccggcagggaagagagcagactgactgtgccggagggcaccatgcctcagcagagc
cctggagcacaatcctcctgcagcagtgaccactccccagcaggcagcgcggccaacacg
gacagcggcgtggagatggccggcaacgcagggggcagcactgaggacttgtccagcttg
gatgaaggaccttgcgttgcggctaccggactctccacccttcgccgccttgagaacctc
aggctggatcagctgcatcagctccggccaatagggtcccggggtctcaaactgcccagc
ttaacccacgctggcgcacctgtgtctcgacgtctgggcccaccggtctcccttgaccgc
cgcagcagcagctccagcagcattagctccgcgtacacagtcagccgccggtcctcgctg
gcatccccgttcccgccgggatccccaccagagaacggggcgtcgtcactacctggcctc
acacctgcccagcactacatgctccgggcaagatatgcttcagccagggggagtggcacc
ccacccactgcagcacacagcctggatcggatcgggggtcttcctgcacctccttggaga
agccgagctgagtacccaggatacaaccccaatgcaggggtcacgaggagggccagtgac
ccagcccgggctgctgaccacccggctccagctagagtacaacggttcaagagcttgggg
tgtgtacacacgcctcctagtgtggcaacaggacggaacttcgatccccacctccctacc
tctgtctattcgccacagccccccagcatcaccgaaaatgttgctatggatactagaggg
ctacagggggagctagaggttggaacttccatgatgggcaatgatctgaacccatacatg
gacttttcttctgctgacactctgggatatggggggcctgaggggacggcggctgagtct
tatggatctaagggtccaggttccctgcctcttgggcctggtccaccaaccaactatggc
cctggccactgtgcccagcaggtctcctatcctgatcccaccccagaaacatggggtgag
tttccttcacatgctggggtgtaccctggcactaaggctctaggtacagcctataaccag
tgtcctcgacttgagcattatggacaagtgcaagtaaaaccagaacaagggtgcccagtg
gggtctgactccaccgggttggcaccctgcctcaatgcccaccccagtgaagggtcccca
gacccacagcctctgttttcacatcactcccagctccctccaccccagtatctccagtca
ggtccctaccctcagcctccccatgactgtctctcgttagaatccaggcctggcctcaat
ttcaacccctcctctcattccacaggacagctcaaagctcagctcctgtgtaattacgtt
cagtcgcagcaggaattgttgtgggagggcagaagccggggagggatccccaaccaggaa
cttccatatcagagccccaagtttctgggaggttctcaagttagtcagagccccaccaag
gtcccagcagcagcagcagcagctacgtttggatctggctttgcatcacctgctttggcc
aatcacaaatcagtctcctatcctgccccttcaccgtgccatgaaactttcaccatggga
gtaaacaggcctccccataggccagcagcaccaccccggcttctgcccccgctaccacct
tgctatgggcccctcaaggtgggagatgccaaccccagctgtgggcatcctgaagtgggc
aggttaggagcaggccctgccttgtaccctccccctgaagggcaggtgtgtaaccctctg
gactctcttgacctggacaacactcagctggactttgtggctatcctagatgaagctcaa
gggctgagccctcctccttcccacgagcaaggggacagctctaaaaacaccccacctccc
tccgggccccccaacatggcagtcggtaacatgagtgtcttactggggtctctgcctgga
gagacgcagttcctcaactctagtgcctaa

KEGG   Rattus norvegicus (rat): 304729
Entry
304729            CDS       T01003                                 

Gene name
Gli2
Definition
(RefSeq) zinc finger protein GLI2
  KO
K16798  zinc finger protein GLI2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04340  Hedgehog signaling pathway
rno04390  Hippo signaling pathway
rno05200  Pathways in cancer
rno05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    304729 (Gli2)
   04390 Hippo signaling pathway
    304729 (Gli2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    304729 (Gli2)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    304729 (Gli2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    304729 (Gli2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    304729 (Gli2)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4
Other DBs
NCBI-GeneID: 304729
NCBI-ProteinID: NP_001100639
RGD: 1309270
Ensembl: ENSRNOG00000007261
Position
13
AA seq 1480 aa
MRHQEGRYHYDPHPVHGVHGPPTLSGSPVISDISLIRLSPHPAGPGESPFSAHHPYMNPH
MEHYLRSVHSSPTLSMISAARGLSPADVAHEHLKERGLFSLAAPGTNPSDYYHQMTLMAS
HPTPYGDILMQSGGAASAPHLHDYLNPVDASRFSSPRVTPRLSRKRALSISPLSDASLDL
QRMIRTSPNSLVAYINNSRSSSAASGSYGHLSAGALSPAFTFPHPINPVAYQQILSQQRG
LGSAFGHTPPLIQPSPTFLAQQPMTLTSITVPTQLGSNSSNCISDANQNKQNSESAVSST
VNPITIHKRSKVKTEAEGLRPASPLGLTQEQLADLKEDLDRDDCKQEAEVVIYETNCHWA
DCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYMLVVHMRRHTGEKP
HKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEK
PYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHLRAPLLKENGDNEAGAEP
GGRGPEESVEASSTSHTAEDCLHIKAIKTESSGLCQSSPGAQSSCSSEPSPLGSVPNNDS
GVEMPGTGPGSLGDLTALDDTSPGADTSALAVPSTGGLQLRKHMTTMHRFEQLKREKLKS
LKDSCSWAGPAPHTRNTKLPPLPVNGSVLENFNNTGGCGPAGLLPNQRLPELTEVTMLSQ
LQERRDSSTSTMSSAYTVSRRSSGISPYFSSRRSSEASPLGGIRPHNASSADSYDPISTD
ASRRSSEASQCSGGGPGLLNLTPAQQYSLRAKYAAATGGPPPTPLPGLDRVSLRTRLALL
DAPERALPGACPQPLGPRRGSDGPTYNHGHGYVGAAPALPHEGPNGSTRRASDPVRRPDP
LVLPRVQRFHSIHNMNPGPLPPCTDRRGLHLQSHPSVDGSLTRHAYSPRPPSINENVVME
AVAAGVEGAGLESDLGLVEDDLVLPDDVVQYIKAHTGGALDDSTRQVYPTEGTGFPENSK
LPSPGLQGHRRLAAADSNMSPSAPGLGGCQLSYSPSSSLNKSNMPVQWNEVSSGTVDALP
TQVKPPSFPQSNLVQQKPAFAHYPGYSPQALQSGSGGLDSTQPHLQLRGAPSASRGSYTQ
QPRLPATGSQCLGVTAAMSPQANYSQTHHQLSPNVVSGSLNQFAPSCSNMAAKPSHLGLP
QQMEVVPNATIISGHQRELGIASSSLAAVSQPHPVLGYPQQDGYQQVSGLPSSHQPSFME
SQQNTGFGLMQPRPPLEPNTASRHRGVRSGQQQQQLYARTAGQAVVTSANQETAEAMPKG
TAGTVVSLTPQPSQDTGRSQDQNTLYYYGQIHMYEQNGGCPAMQPQPPQPQGCSDNIQPE
PLPSPGVNQVSSTVDSQLLEPPQIDFDAIMDDGDHSSLFSGALSPSLLHNLSQNSSRLTT
PRNSLTLPSIPVGISNMAVGDMSSMLTSLAEENKFLNMMT
NT seq 4443 nt   +upstreamnt  +downstreamnt
atgagacaccaggagggaaggtaccattatgaccctcaccctgtccacggtgtgcacggg
cctcccacgctaagtggcagtcctgtcatctcagatatctccttgatacgactttctcca
caccctgctggccctggagaatcgcccttcagcgcccaccacccctacatgaacccccac
atggagcactacctccggtctgtgcacagcagccccacactctcaatgatctctgccgcc
aggggcctcagccctgctgatgtggcccatgaacatctgaaagagaggggactatttagt
ctcgctgccccaggcaccaacccttcagactattaccaccagatgaccctcatggcaagc
caccccacaccctacggggacattctaatgcaaagtggcggtgctgctagcgcaccccat
ctccatgactacctcaaccctgtggatgcatcacgattctccagcccacgtgtgaccccg
cgactgagccgcaagcgggctctatccatctccccgctctcagatgccagccttgaccta
cagcgcatgatccggacctctcccaactcactggtagcctacatcaacaactccaggagc
agctcagcagccagcggttcttacgggcatctgtcagctggtgccctcagcccagccttc
accttcccccaccccatcaatcccgtggcgtaccagcagatcctgagccagcagcggggc
ctgggttcagcctttggacatacaccacccctgatccagccttcacccaccttcttggct
cagcagcccatgactctcacctccatcaccgtgcctacccagctaggcagcaatagcagc
aactgtataagtgatgccaaccagaataagcagaacagcgagtcggccgtgagcagcacc
gtgaaccccatcaccatccataagcggagcaaggtcaagactgaggctgagggcctacgg
ccagcctccccgcttggactgacacaggagcaactggctgatctcaaggaagatctggac
agggatgactgtaagcaggaggctgaagtggtcatctacgagaccaactgccactgggca
gactgcacgaaggaatatgacacccaggagcagctggtgcatcacatcaacaatgagcac
atccacggggagaagaaggagttcgtgtgccgctggcaggcctgcacgagagagcagaag
cccttcaaggcccagtacatgctggttgtccacatgcgcaggcacacgggtgagaagccg
cacaagtgcacgtttgaaggctgctcaaaggcctactctcgcctggagaacttgaagaca
cacctgcggtcccacacaggggagaagccctatgtgtgtgaacacgaaggctgcaacaaa
gccttctccaatgcctcggaccgtgccaagcaccagaaccgcactcactccaatgagaaa
ccctacatctgtaagatcccaggctgcactaagaggtacacagaccccagctcactccgc
aagcatgtgaagaccgtccacgggccagatgcccatgtgaccaagaaacagcgtaatgat
gtgcacctccgtgctccactgctcaaggagaatggggacaatgaggccggtgctgagcca
ggtggccggggacccgaggagagtgtggaggccagtagcaccagtcacactgcggaggac
tgcctgcatatcaaagccatcaagacagagagctccgggctgtgccagtccagccccggg
gcccagtcatcctgcagcagcgagccctctcccctgggcagtgtccccaacaatgacagt
ggcgtggagatgccggggacagggcccgggagtctgggagacctgacagcactggacgac
acgtctccaggagctgacacatcagccctggctgtaccttccactggtggcctgcagctg
cgcaaacacatgaccaccatgcatcgctttgagcagctgaagagagagaagctcaagtct
ctaaaggattcctgctcgtgggctggcccagccccacacacccgcaacaccaagctgcct
ccccttccagtgaatggttctgttctggaaaacttcaacaatactgggggctgtggacca
gcgggactgctgcccaaccagcggctaccagaactgacagaagtgaccatgctgagccag
ctgcaggaacggagagacagctccaccagcactatgagctcagcctacaccgtgagccgc
cgctcctccggcatctccccatacttctccagccgccgttccagcgaggcctcgcctctt
ggtggcatacgcccgcacaatgccagctcagcggactcctacgaccccatctccacagac
gcctctcggcgctccagtgaggccagtcagtgcagcggtggtggccccgggctgctcaac
ctgacacccgcacagcagtatagcctgcgtgccaagtacgcagcggccacaggcgggcca
ccacccacgccactgccgggcctcgaccgcgtcagccttcgtacccgcctggcattacta
gatgctcctgagcgtgcactgccaggcgcctgcccacaacctctggggccacggcgtggt
agcgacgggcctacctataaccacggccatggctatgtaggtgcggctcctgccttaccc
catgaggggcctaacggcagcacacggcgggccagcgaccctgtgcggcgacctgacccc
cttgttctgcctcgagtgcaacgtttccacagcatccacaacatgaatccaggtccgctg
cccccctgcactgatcggcgtggcctgcatttacagagccaccccagcgtagatggcagc
ctgacccgccatgcctactctccgcgaccccctagcatcaatgagaacgtggtgatggaa
gccgtggctgctggggtagagggtgccgggctagagtctgacctggggctggtggaggat
gacctcgtgctgccagatgatgtggtacagtacatcaaggctcacacaggtggtgccttg
gatgacagcacacggcaggtgtatcccacagaaggtactggcttccccgagaactctaaa
ctgcccagtcccgggctacaaggccaccgcaggctagcggctgccgactccaacatgagc
ccttctgctcctgggctgggaggctgccagctgagctacagcccctcctccagcctcaac
aagagcaacatgcctgtgcagtggaacgaggtgagttctggcaccgtggatgccctgccc
acccaggtgaagccaccctcttttcctcagagcaacctggttcagcagaagccagccttt
gcccactatccaggctatagcccacaagccctgcagagcggctctggaggtctagacagc
acccaaccacacctacagcttcgaggggccccctctgcatcaagagggagctacacgcaa
cagcctcgactgccagctacaggcagtcagtgcctgggtgtaactgcagccatgagccct
caggccaactacagccaaacccaccaccagctgagtccaaacgtcgtcagtggatctctg
aaccagtttgccccctcctgcagcaatatggcagccaagcctagccacctgggactccct
cagcaaatggaagttgtccccaatgccaccatcataagtggccatcaacgggaacttggg
attgccagttcatccctggctgcagtgtcacaacctcacccagtcctgggctatccccag
caggacggctaccaacaggtctctggccttccgtcatcccatcagcctagcttcatggag
tcccagcagaacacgggctttggtctcatgcaacctcggccgcccctggagcccaacaca
gctagtcgtcaccgaggagtacgttctggccaacagcagcagcagctgtatgccaggacc
gctggccaagccgtggtcacatcagccaaccaagagacagcagaagctatgcccaaggga
acagcagggaccgtggtatccctaactcctcagccatctcaggacacagggcggtcacag
gaccagaacacgctctactactatggccagatccacatgtatgaacagaacggaggctgc
ccagccatgcagccccagccgccacaaccacaaggttgctcagacaatatccagcctgaa
cctctgccttcaccaggagtcaaccaggtgtccagcaccgtggactcccagctcctggag
cccccccagattgactttgatgccatcatggacgatggcgatcactcgagtttgttctct
ggtgcactgagcccaagcctgctccacaatctctcccagaattcctcacgcctcaccaca
ccccggaattccctgacactgccctccatccccgtgggcatcagcaacatggctgttggg
gacatgagttccatgctcaccagcttggctgaagagaacaagtttttaaacatgatgacc
tag

DBGET integrated database retrieval system