KEGG   Rattus norvegicus (rat): 140942
Entry
140942            CDS       T01003                                 

Gene name
Ddit4
Definition
(RefSeq) DNA damage-inducible transcript 4 protein
  KO
K08270  DNA-damage-inducible transcript 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    140942 (Ddit4)
   04150 mTOR signaling pathway
    140942 (Ddit4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    140942 (Ddit4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    140942 (Ddit4)
SSDB
Motif
Pfam: RTP801_C
Other DBs
NCBI-GeneID: 140942
NCBI-ProteinID: NP_543182
RGD: 621731
Ensembl: ENSRNOG00000057078
UniProt: Q8VHZ9
Position
20
AA seq 229 aa
MPSLWDRFSSSSSSSSSSRTPAADRPPRSAWGSAAREEGLDRCASLESSDCESLDSSNSG
FGPEEDSSYLDGVSLPDFELLSDPEDEHLCANLMQLLQESLSQARLGSRRPARLLMPSQL
LSQVGKELLRLAYSEPCGLRGALLDVCVEQGKSCHSVAQLALDPSLVPTFQLTLVLRLDS
RLWPKIQGLLSSANSSLVPGYSQSLTLSTGFRVIKKKLYSSEQLLIEEC
NT seq 690 nt   +upstreamnt  +downstreamnt
atgcctagcctttgggatcgtttctcgtcctcctcttcctcttcgtcctcgtcccgaact
ccggccgctgatcggccgccgcgctccgcctgggggtctgcggccagagaagagggcctt
gaccgctgcgcgagcctggagagctcggactgcgagtccctggacagcagcaacagtggc
tttgggccggaggaagactcctcatacctggatggggtgtctctgcctgactttgagctg
ctcagtgaccccgaggatgagcacctgtgtgccaacctgatgcagctgctgcaggagagc
ctgtcccaggcgcgattgggctcgcggcgccctgcgcgcctgctgatgccgagccagctg
ttgagccaggtgggcaaggaactcctgcgcctggcgtacagcgagccgtgcggcctgcgg
ggggcactgctggacgtctgtgtggagcaaggcaagagctgccatagtgtggctcagctg
gctctggaccccagtctagtgcccacctttcagttgaccctggtgctgcgtctggactct
cgcctctggcccaagatccagggcctgttgagttctgccaactcttccttggtccctggt
tacagccagtccctgacgctgagcaccggcttcagagtcatcaaaaagaaactctacagc
tccgagcagctgctcattgaagagtgttga

DBGET integrated database retrieval system