KEGG   Rattus norvegicus (rat): 156435
Entry
156435            CDS       T01003                                 

Gene name
Tmprss2
Definition
(RefSeq) transmembrane protease serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05164  Influenza A
rno05171  Coronavirus disease - COVID-19
rno05202  Transcriptional misregulation in cancer
rno05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    156435 (Tmprss2)
  09162 Cancer: specific types
   05215 Prostate cancer
    156435 (Tmprss2)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    156435 (Tmprss2)
   05164 Influenza A
    156435 (Tmprss2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    156435 (Tmprss2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     156435 (Tmprss2)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S1: chymotrypsin family
   156435 (Tmprss2)
SSDB
Motif
Pfam: Trypsin SRCR_2 DUF1986 Hepsin-SRCR Ldl_recept_a SRCR Trypsin_2
Other DBs
NCBI-GeneID: 156435
NCBI-ProteinID: NP_569108
RGD: 620766
Ensembl: ENSRNOG00000001976
UniProt: Q6P7D7
Position
11
AA seq 490 aa
MALNSGSPPGIGPYYENHGYQSEHVYSPRPPVSPSGYNLYPAQSCPSPVPQYAPRVTTQA
STPAIHIQPRSSGTLCTSKSKKSMLVALALGTVLAGAAVAAGLLWKFWDSKCSSSEMECG
SSGTCISSSLWCDGVSQCPNGEDENRCVRLYGTSFTLQVYSSQRKAWYPVCQDDWNESYG
RAACKDMGYKNSFYSSQGIPDQSGATSFMKLNVSAGNVDLYKKLYHSDSCSSRMVVSLRC
IECGVRSVRRQSRIVGGSTASPGDWPWQVSLHVQGIHVCGGSIITPEWIVTAAHCVEEPL
SSPRYWTAFAGILKQSLMFYGSRHQVEKVISHPNYDSKTKNNDIALMKLQTPLAFNDVVK
PVCLPNPGMMLDLAQECWISGWGATYEKGKTSDVLNAAMVPLIEPSKCNSKYIYNNLITP
AMICAGFLQGSVDSCQGDSGGPLVTLKNEIWWLIGDTSWGSGCAKAYRPGVYGNVTVFTD
WIYQQMRANS
NT seq 1473 nt   +upstreamnt  +downstreamnt
atggcattgaactcagggtcacctccaggaattggaccttactatgagaaccacgggtat
cagtctgagcacgtctattccccgaggccacctgtgtctcccagtggctacaacttgtat
ccagcccagagctgcccatctccagtgccccagtatgctccgagagtcacaactcaagcc
tcaacacctgccatccacatacagccccgatcctcaggaacactgtgcacctcaaaatct
aagaaatccatgcttgtcgccctggccctgggcactgtcctcgccggtgctgctgtggct
gctggcttgctttggaagttctgggacagcaagtgctcttcatcagagatggagtgtggg
tcttcagggacatgtatcagctcctccctctggtgtgacggagtgtcacagtgtcccaac
ggggaagacgagaaccggtgtgttcgcctctatggaacaagcttcaccctccaggtttac
tcatctcagaggaaagcctggtatcccgtctgccaggatgattggaatgagagctacggg
agagcagcatgtaaagacatgggatacaagaacagcttttattctagccaagggatacca
gaccagagcggggcaacgagctttatgaagctgaatgtgagcgcaggcaacgtcgacctc
tataaaaaactctaccacagtgactcgtgctcatcccgcatggtggtttctttgcgctgt
atagaatgcggggttcgctcagtaagacgtcagagcaggattgtgggtgggtcgaccgcc
tcaccaggagactggccctggcaggtcagcctgcacgtccaaggtatccatgtctgcgga
ggctccatcatcacccccgagtggattgtgacagccgcccactgtgtggaagaacccctc
agcagccctaggtactggacggcatttgcgggaattttgaaacagtctctcatgttctat
ggaagtagacaccaggtagaaaaagtgatttcccatccaaattacgactctaagaccaag
aataatgacattgctctcatgaagctgcagacacccttggcttttaatgatgtagtgaag
ccagtgtgtctgccgaacccaggcatgatgctggacctagcccaggagtgctggatttca
gggtggggggccacctatgagaaagggaagacctcagatgtgctgaatgctgccatggta
cccttgatcgagccctccaaatgtaatagcaaatacatatacaacaacttaatcacacca
gccatgatctgcgccgggttcctccagggctctgtcgactcttgtcagggagacagtgga
gggcccctggttactttgaagaatgaaatctggtggctgattggggacacgagctggggc
tcgggctgtgccaaggcatacagacctggagtatacgggaatgtgacagtatttacagat
tggatctaccagcaaatgagggcgaacagctaa

DBGET integrated database retrieval system