KEGG   Rattus norvegicus (rat): 170911
Entry
170911            CDS       T01003                                 

Gene name
Pik3ca
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno01524  Platinum drug resistance
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04066  HIF-1 signaling pathway
rno04068  FoxO signaling pathway
rno04070  Phosphatidylinositol signaling system
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04210  Apoptosis
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04218  Cellular senescence
rno04360  Axon guidance
rno04370  VEGF signaling pathway
rno04380  Osteoclast differentiation
rno04510  Focal adhesion
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno04620  Toll-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04630  JAK-STAT signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04668  TNF signaling pathway
rno04670  Leukocyte transendothelial migration
rno04722  Neurotrophin signaling pathway
rno04725  Cholinergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04810  Regulation of actin cytoskeleton
rno04910  Insulin signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04915  Estrogen signaling pathway
rno04917  Prolactin signaling pathway
rno04919  Thyroid hormone signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04926  Relaxin signaling pathway
rno04929  GnRH secretion
rno04930  Type II diabetes mellitus
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04935  Growth hormone synthesis, secretion and action
rno04960  Aldosterone-regulated sodium reabsorption
rno04973  Carbohydrate digestion and absorption
rno05010  Alzheimer disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05100  Bacterial invasion of epithelial cells
rno05132  Salmonella infection
rno05135  Yersinia infection
rno05142  Chagas disease
rno05146  Amoebiasis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05207  Chemical carcinogenesis - receptor activation
rno05210  Colorectal cancer
rno05211  Renal cell carcinoma
rno05212  Pancreatic cancer
rno05213  Endometrial cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05218  Melanoma
rno05220  Chronic myeloid leukemia
rno05221  Acute myeloid leukemia
rno05222  Small cell lung cancer
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05230  Central carbon metabolism in cancer
rno05231  Choline metabolism in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05415  Diabetic cardiomyopathy
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    170911 (Pik3ca)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    170911 (Pik3ca)
   04014 Ras signaling pathway
    170911 (Pik3ca)
   04015 Rap1 signaling pathway
    170911 (Pik3ca)
   04370 VEGF signaling pathway
    170911 (Pik3ca)
   04630 JAK-STAT signaling pathway
    170911 (Pik3ca)
   04668 TNF signaling pathway
    170911 (Pik3ca)
   04066 HIF-1 signaling pathway
    170911 (Pik3ca)
   04068 FoxO signaling pathway
    170911 (Pik3ca)
   04070 Phosphatidylinositol signaling system
    170911 (Pik3ca)
   04072 Phospholipase D signaling pathway
    170911 (Pik3ca)
   04071 Sphingolipid signaling pathway
    170911 (Pik3ca)
   04024 cAMP signaling pathway
    170911 (Pik3ca)
   04151 PI3K-Akt signaling pathway
    170911 (Pik3ca)
   04152 AMPK signaling pathway
    170911 (Pik3ca)
   04150 mTOR signaling pathway
    170911 (Pik3ca)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    170911 (Pik3ca)
  09143 Cell growth and death
   04210 Apoptosis
    170911 (Pik3ca)
   04218 Cellular senescence
    170911 (Pik3ca)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    170911 (Pik3ca)
   04550 Signaling pathways regulating pluripotency of stem cells
    170911 (Pik3ca)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    170911 (Pik3ca)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    170911 (Pik3ca)
   04613 Neutrophil extracellular trap formation
    170911 (Pik3ca)
   04620 Toll-like receptor signaling pathway
    170911 (Pik3ca)
   04625 C-type lectin receptor signaling pathway
    170911 (Pik3ca)
   04650 Natural killer cell mediated cytotoxicity
    170911 (Pik3ca)
   04660 T cell receptor signaling pathway
    170911 (Pik3ca)
   04662 B cell receptor signaling pathway
    170911 (Pik3ca)
   04664 Fc epsilon RI signaling pathway
    170911 (Pik3ca)
   04666 Fc gamma R-mediated phagocytosis
    170911 (Pik3ca)
   04670 Leukocyte transendothelial migration
    170911 (Pik3ca)
   04062 Chemokine signaling pathway
    170911 (Pik3ca)
  09152 Endocrine system
   04910 Insulin signaling pathway
    170911 (Pik3ca)
   04923 Regulation of lipolysis in adipocytes
    170911 (Pik3ca)
   04929 GnRH secretion
    170911 (Pik3ca)
   04915 Estrogen signaling pathway
    170911 (Pik3ca)
   04914 Progesterone-mediated oocyte maturation
    170911 (Pik3ca)
   04917 Prolactin signaling pathway
    170911 (Pik3ca)
   04926 Relaxin signaling pathway
    170911 (Pik3ca)
   04935 Growth hormone synthesis, secretion and action
    170911 (Pik3ca)
   04919 Thyroid hormone signaling pathway
    170911 (Pik3ca)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    170911 (Pik3ca)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    170911 (Pik3ca)
  09156 Nervous system
   04725 Cholinergic synapse
    170911 (Pik3ca)
   04722 Neurotrophin signaling pathway
    170911 (Pik3ca)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    170911 (Pik3ca)
  09158 Development and regeneration
   04360 Axon guidance
    170911 (Pik3ca)
   04380 Osteoclast differentiation
    170911 (Pik3ca)
  09149 Aging
   04211 Longevity regulating pathway
    170911 (Pik3ca)
   04213 Longevity regulating pathway - multiple species
    170911 (Pik3ca)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    170911 (Pik3ca)
   05206 MicroRNAs in cancer
    170911 (Pik3ca)
   05205 Proteoglycans in cancer
    170911 (Pik3ca)
   05207 Chemical carcinogenesis - receptor activation
    170911 (Pik3ca)
   05203 Viral carcinogenesis
    170911 (Pik3ca)
   05230 Central carbon metabolism in cancer
    170911 (Pik3ca)
   05231 Choline metabolism in cancer
    170911 (Pik3ca)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    170911 (Pik3ca)
  09162 Cancer: specific types
   05210 Colorectal cancer
    170911 (Pik3ca)
   05212 Pancreatic cancer
    170911 (Pik3ca)
   05225 Hepatocellular carcinoma
    170911 (Pik3ca)
   05226 Gastric cancer
    170911 (Pik3ca)
   05214 Glioma
    170911 (Pik3ca)
   05221 Acute myeloid leukemia
    170911 (Pik3ca)
   05220 Chronic myeloid leukemia
    170911 (Pik3ca)
   05218 Melanoma
    170911 (Pik3ca)
   05211 Renal cell carcinoma
    170911 (Pik3ca)
   05215 Prostate cancer
    170911 (Pik3ca)
   05213 Endometrial cancer
    170911 (Pik3ca)
   05224 Breast cancer
    170911 (Pik3ca)
   05222 Small cell lung cancer
    170911 (Pik3ca)
   05223 Non-small cell lung cancer
    170911 (Pik3ca)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    170911 (Pik3ca)
   05170 Human immunodeficiency virus 1 infection
    170911 (Pik3ca)
   05161 Hepatitis B
    170911 (Pik3ca)
   05160 Hepatitis C
    170911 (Pik3ca)
   05171 Coronavirus disease - COVID-19
    170911 (Pik3ca)
   05164 Influenza A
    170911 (Pik3ca)
   05162 Measles
    170911 (Pik3ca)
   05168 Herpes simplex virus 1 infection
    170911 (Pik3ca)
   05163 Human cytomegalovirus infection
    170911 (Pik3ca)
   05167 Kaposi sarcoma-associated herpesvirus infection
    170911 (Pik3ca)
   05169 Epstein-Barr virus infection
    170911 (Pik3ca)
   05165 Human papillomavirus infection
    170911 (Pik3ca)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    170911 (Pik3ca)
   05135 Yersinia infection
    170911 (Pik3ca)
   05100 Bacterial invasion of epithelial cells
    170911 (Pik3ca)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    170911 (Pik3ca)
   05142 Chagas disease
    170911 (Pik3ca)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    170911 (Pik3ca)
   05017 Spinocerebellar ataxia
    170911 (Pik3ca)
   05020 Prion disease
    170911 (Pik3ca)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    170911 (Pik3ca)
   05418 Fluid shear stress and atherosclerosis
    170911 (Pik3ca)
   05415 Diabetic cardiomyopathy
    170911 (Pik3ca)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    170911 (Pik3ca)
   04932 Non-alcoholic fatty liver disease
    170911 (Pik3ca)
   04931 Insulin resistance
    170911 (Pik3ca)
   04933 AGE-RAGE signaling pathway in diabetic complications
    170911 (Pik3ca)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    170911 (Pik3ca)
   01524 Platinum drug resistance
    170911 (Pik3ca)
   01522 Endocrine resistance
    170911 (Pik3ca)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    170911 (Pik3ca)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     170911 (Pik3ca)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    170911 (Pik3ca)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ABC1 Ribosomal_S15
Other DBs
NCBI-GeneID: 170911
NCBI-ProteinID: NP_596890
RGD: 620916
Ensembl: ENSRNOG00000056371
UniProt: A0A0G2K344
Position
2
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLVTIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFV
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPID
SFTMPSYSRRISTATPYMNGETATKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHTGLSNRLARDNELRENDKEQLRALCTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRSFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRQPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQEYTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFTKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccacgaccatcttcgggtgaactgtggggcatccacttgatgcccccacgaatc
ctagtggaatgtttactcccaaatggaatgatagtgactttagaatgcctccgtgaggcc
acactagtcaccatcaagcatgaactgttcaaagaggccaggaaataccctctccatcag
cttctgcaagatgaatcatcttacattttcgtaagtgttacccaagaagcagaaagggaa
gaatttttcgatgaaacaagacggctttgtgaccttcggctttttcaaccctttttaaaa
gtaattgagccagtaggcaaccgtgaagaaaagatcctcaaccgagaaattggttttgtt
attggcatgccagtgtgtgaatttgatatggttaaagatccagaagtccaagacttccga
aggaacattctgaatgtttgcaaagaagccgtggacctgcgggatctcaactcgcctcat
agcagagcaatgtatgtctaccctccaaatgtcgagtcttccccagaactgccaaagcac
atctacaacaagttagataaaggacaaatcatagtggtgatttgggtgatagtctctcca
aacaacgacaagcagaagtacactctgaagatcaaccatgactgcgtgccagagcaagtc
attgctgaggccatcaggaagaagacccggagcatgttgctgtcctcggagcagctgaaa
ctctgtgtcttagaataccagggcaagtacattctcaaagtgtgtggctgtgatgagtac
ttcctagagaagtaccctctgagtcagtacaagtacataagaagctgtataatgctgggg
aggatgcccaacttgatgctgatggccaaggagagcctgtactctcagctgccgatcgat
agcttcacaatgccatcctactccaggcgcatttccacagcgacaccctatatgaacggg
gagactgctacgaaatccctctgggttataaatagcgcgctcagaataaaaattctgtgt
gcaacctatgtaaatgtaaatattcgagacattgataagatctatgttcgaacaggtatc
taccatggaggagaacccttatgtgacaatgtgaatactcaaagagtcccttgttccaat
cctaggtggaatgaatggctgaattatgatatatacattcctgatcttcctcgtgctgcc
cgcctttgcctttcaatctgctctgttaaaggccgaaagggtgctaaggaggagcactgt
ccgttggcctggggaaacataaacttgtttgattatacagacaccctagtgtccgggaaa
atggctttgaatctctggcctgtaccacatgggttggaagatctgctgaaccctattggt
gttactgggtcaaatccaaataaagaaactccatgcttagagttggagtttgattggttc
agcagtgtggtgaagtttccagatatgtctgtgatcgaagagcatgccaattggtctgtg
tcccgagaagccggattcagttactctcatacaggactgagtaacagactagccagagac
aatgagttaagagaaaatgacaaggaacagctccgagcactttgtacccgggacccactg
tctgaaatcactgaacaagagaaagacttcctatggagccacagacactactgtgtaact
attcctgaaatcctacccaaattgcttctgtctgtcaagtggaattccagagatgaagtg
gcccagatgtactgcttagtaaaagattggcctccaatcaaaccagagcaagccatggag
ctcctggactgtaactacccagaccccatggttcggagctttgctgtccggtgcttggaa
aaatacttaacagatgacaaactttctcagtacctcatccagcttgtacaggtcttaaaa
tatgaacagtatttggataacctgcttgtgagatttttactcaagaaagcactgacaaat
caaaggattggccattttttcttttggcatttaaaatctgagatgcacaataagactgtc
agtcagaggttcggcctgctgttggagtcctactgccgtgcctgtgggatgtatctgaag
cacctgaacagacaggtagaggccatggagaagctcatcaatctaactgacatcctcaag
caggagaagaaggatgagacacagaaggtacagatgaagttcttggttgaacagatgaga
cagccagatttcatggatgctttgcagggttttctgtcccctctaaatcctgctcatcaa
ctaggaaacctcaggcttgaagagtgtcgaattatgtcctctgcaaaaaggccactgtgg
ttgaattgggagaacccagacatcatgtcagagctactgtttcagaacaatgagatcatc
tttaaaaatggcgatgacttacggcaagacatgttaacccttcagatcatccgaatcatg
gagaacatctggcaaaaccaaggccttgaccttcgcatgctaccttatggctgtctatcc
attggggactgtgtgggtctcatcgaggtggtgagaaactctcacaccatcatgcagatt
cagtgcaaaggaggcctgaagggggcactgcagttcaacagccacacgctgcatcagtgg
ctcaaggacaagaacaagggcgagatatatgatgcagccattgacctgttcactcggtcc
tgcgctgggtactgcgtggcaacctttatcttgggaattggagaccggcacaacagcaac
atcatggtgaaagatgacggacagctgtttcatatagattttgggcactttttggatcac
aagaagaaaaaatttggctataaacgggaacgtgtgccgtttgttttgacgcaggatttc
ttaatagtgattagtaaaggagcacaagagtacacaaagaccagagagtttgagaggttt
caggagatgtgttacaaggcgtacctagcaattcggcagcatgccaatctcttcatcaac
cttttctccatgatgcttggctccggaatgccagaactgcagtctttcgatgatattgca
tatattcgaaagactctagccttagacaaaactgagcaagaggctctggagtatttcaca
aagcaaatgaatgacgcacatcatggtggctggacaacaaaaatggactggatcttccac
accatcaagcagcatgcattgaactga

KEGG   Rattus norvegicus (rat): 25513
Entry
25513             CDS       T01003                                 

Gene name
Pik3r1
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno01524  Platinum drug resistance
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04066  HIF-1 signaling pathway
rno04068  FoxO signaling pathway
rno04070  Phosphatidylinositol signaling system
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04210  Apoptosis
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04218  Cellular senescence
rno04360  Axon guidance
rno04370  VEGF signaling pathway
rno04380  Osteoclast differentiation
rno04510  Focal adhesion
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno04620  Toll-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04630  JAK-STAT signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04668  TNF signaling pathway
rno04670  Leukocyte transendothelial migration
rno04722  Neurotrophin signaling pathway
rno04725  Cholinergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04810  Regulation of actin cytoskeleton
rno04910  Insulin signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04915  Estrogen signaling pathway
rno04917  Prolactin signaling pathway
rno04919  Thyroid hormone signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04926  Relaxin signaling pathway
rno04929  GnRH secretion
rno04930  Type II diabetes mellitus
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04935  Growth hormone synthesis, secretion and action
rno04960  Aldosterone-regulated sodium reabsorption
rno04973  Carbohydrate digestion and absorption
rno05010  Alzheimer disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05100  Bacterial invasion of epithelial cells
rno05135  Yersinia infection
rno05142  Chagas disease
rno05146  Amoebiasis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05207  Chemical carcinogenesis - receptor activation
rno05210  Colorectal cancer
rno05211  Renal cell carcinoma
rno05212  Pancreatic cancer
rno05213  Endometrial cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05218  Melanoma
rno05220  Chronic myeloid leukemia
rno05221  Acute myeloid leukemia
rno05222  Small cell lung cancer
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05230  Central carbon metabolism in cancer
rno05231  Choline metabolism in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05415  Diabetic cardiomyopathy
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    25513 (Pik3r1)
   04014 Ras signaling pathway
    25513 (Pik3r1)
   04015 Rap1 signaling pathway
    25513 (Pik3r1)
   04370 VEGF signaling pathway
    25513 (Pik3r1)
   04630 JAK-STAT signaling pathway
    25513 (Pik3r1)
   04668 TNF signaling pathway
    25513 (Pik3r1)
   04066 HIF-1 signaling pathway
    25513 (Pik3r1)
   04068 FoxO signaling pathway
    25513 (Pik3r1)
   04070 Phosphatidylinositol signaling system
    25513 (Pik3r1)
   04072 Phospholipase D signaling pathway
    25513 (Pik3r1)
   04071 Sphingolipid signaling pathway
    25513 (Pik3r1)
   04024 cAMP signaling pathway
    25513 (Pik3r1)
   04151 PI3K-Akt signaling pathway
    25513 (Pik3r1)
   04152 AMPK signaling pathway
    25513 (Pik3r1)
   04150 mTOR signaling pathway
    25513 (Pik3r1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    25513 (Pik3r1)
  09143 Cell growth and death
   04210 Apoptosis
    25513 (Pik3r1)
   04218 Cellular senescence
    25513 (Pik3r1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    25513 (Pik3r1)
   04550 Signaling pathways regulating pluripotency of stem cells
    25513 (Pik3r1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    25513 (Pik3r1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    25513 (Pik3r1)
   04613 Neutrophil extracellular trap formation
    25513 (Pik3r1)
   04620 Toll-like receptor signaling pathway
    25513 (Pik3r1)
   04625 C-type lectin receptor signaling pathway
    25513 (Pik3r1)
   04650 Natural killer cell mediated cytotoxicity
    25513 (Pik3r1)
   04660 T cell receptor signaling pathway
    25513 (Pik3r1)
   04662 B cell receptor signaling pathway
    25513 (Pik3r1)
   04664 Fc epsilon RI signaling pathway
    25513 (Pik3r1)
   04666 Fc gamma R-mediated phagocytosis
    25513 (Pik3r1)
   04670 Leukocyte transendothelial migration
    25513 (Pik3r1)
   04062 Chemokine signaling pathway
    25513 (Pik3r1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    25513 (Pik3r1)
   04923 Regulation of lipolysis in adipocytes
    25513 (Pik3r1)
   04929 GnRH secretion
    25513 (Pik3r1)
   04915 Estrogen signaling pathway
    25513 (Pik3r1)
   04914 Progesterone-mediated oocyte maturation
    25513 (Pik3r1)
   04917 Prolactin signaling pathway
    25513 (Pik3r1)
   04926 Relaxin signaling pathway
    25513 (Pik3r1)
   04935 Growth hormone synthesis, secretion and action
    25513 (Pik3r1)
   04919 Thyroid hormone signaling pathway
    25513 (Pik3r1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    25513 (Pik3r1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    25513 (Pik3r1)
  09156 Nervous system
   04725 Cholinergic synapse
    25513 (Pik3r1)
   04722 Neurotrophin signaling pathway
    25513 (Pik3r1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    25513 (Pik3r1)
  09158 Development and regeneration
   04360 Axon guidance
    25513 (Pik3r1)
   04380 Osteoclast differentiation
    25513 (Pik3r1)
  09149 Aging
   04211 Longevity regulating pathway
    25513 (Pik3r1)
   04213 Longevity regulating pathway - multiple species
    25513 (Pik3r1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25513 (Pik3r1)
   05206 MicroRNAs in cancer
    25513 (Pik3r1)
   05205 Proteoglycans in cancer
    25513 (Pik3r1)
   05207 Chemical carcinogenesis - receptor activation
    25513 (Pik3r1)
   05203 Viral carcinogenesis
    25513 (Pik3r1)
   05230 Central carbon metabolism in cancer
    25513 (Pik3r1)
   05231 Choline metabolism in cancer
    25513 (Pik3r1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    25513 (Pik3r1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    25513 (Pik3r1)
   05212 Pancreatic cancer
    25513 (Pik3r1)
   05225 Hepatocellular carcinoma
    25513 (Pik3r1)
   05226 Gastric cancer
    25513 (Pik3r1)
   05214 Glioma
    25513 (Pik3r1)
   05221 Acute myeloid leukemia
    25513 (Pik3r1)
   05220 Chronic myeloid leukemia
    25513 (Pik3r1)
   05218 Melanoma
    25513 (Pik3r1)
   05211 Renal cell carcinoma
    25513 (Pik3r1)
   05215 Prostate cancer
    25513 (Pik3r1)
   05213 Endometrial cancer
    25513 (Pik3r1)
   05224 Breast cancer
    25513 (Pik3r1)
   05222 Small cell lung cancer
    25513 (Pik3r1)
   05223 Non-small cell lung cancer
    25513 (Pik3r1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    25513 (Pik3r1)
   05170 Human immunodeficiency virus 1 infection
    25513 (Pik3r1)
   05161 Hepatitis B
    25513 (Pik3r1)
   05160 Hepatitis C
    25513 (Pik3r1)
   05171 Coronavirus disease - COVID-19
    25513 (Pik3r1)
   05164 Influenza A
    25513 (Pik3r1)
   05162 Measles
    25513 (Pik3r1)
   05168 Herpes simplex virus 1 infection
    25513 (Pik3r1)
   05163 Human cytomegalovirus infection
    25513 (Pik3r1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    25513 (Pik3r1)
   05169 Epstein-Barr virus infection
    25513 (Pik3r1)
   05165 Human papillomavirus infection
    25513 (Pik3r1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    25513 (Pik3r1)
   05100 Bacterial invasion of epithelial cells
    25513 (Pik3r1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    25513 (Pik3r1)
   05142 Chagas disease
    25513 (Pik3r1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    25513 (Pik3r1)
   05017 Spinocerebellar ataxia
    25513 (Pik3r1)
   05020 Prion disease
    25513 (Pik3r1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    25513 (Pik3r1)
   05418 Fluid shear stress and atherosclerosis
    25513 (Pik3r1)
   05415 Diabetic cardiomyopathy
    25513 (Pik3r1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    25513 (Pik3r1)
   04932 Non-alcoholic fatty liver disease
    25513 (Pik3r1)
   04931 Insulin resistance
    25513 (Pik3r1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    25513 (Pik3r1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    25513 (Pik3r1)
   01524 Platinum drug resistance
    25513 (Pik3r1)
   01522 Endocrine resistance
    25513 (Pik3r1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    25513 (Pik3r1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    25513 (Pik3r1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_2 SH3_9 Laminin_I Mod_r DUF4201 PI_PP_I Bap31_Bap29_C
Other DBs
NCBI-GeneID: 25513
NCBI-ProteinID: NP_037137
RGD: 3329
Ensembl: ENSRNOG00000018903
UniProt: Q63787
Structure
PDB: 
1FU5 1FU6

Position
2
AA seq 724 aa
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEDIGWLNGYN
ETTGERGDFPGTYVEYIGRKRISPPTPKPRPPRPLPVAPGSSKTEADTEQPVLTLPDLAE
QFAPPDVAPPLLIKLLEAIEKKGLECSTLYRTQSSSNPAELRQLLDCDPPSVDLDVFDEH
VLADAFKRYLADLPNPVIPVAVYNEMMSLAQEVPSSEDYIQLLKKLIRSPNIPHQYWLTL
QYLLKHFFKLSQASSKNLLNARALSEIFSHVLFRFPAASSDNTEHLIKAVELLISAEWSE
RQPAPALPPKPPKPTSIANNSMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMK
RTAIEAFNDTIKIFEEQCHPQERYSKDYIEKFKREGNEKEIQRIMHNHDKLKSRISEIID
SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
ENTEDQYSLVDDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACS
VVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA
QQRR
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgagcgcagaggggtaccagtacagagcgctgtatgactacaaaaaggaacgagaggaa
gacatcgacctacacttgggggacatcctgactgtgaataaaggctccttagtggcactt
ggattcagtgatggccaggaagcccggccagaagatattggctggttaaatggttacaat
gaaactactggggagaggggagactttccaggaacttatgttgagtacattggaaggaaa
agaatttcaccccccactcctaagccacggccccctcgacctcttcctgtagcacccggt
tcttcaaaaactgaagcagacactgagcaaccagtgttgacccttcctgatctggccgag
cagtttgcccctcctgatgttgccccgcctctccttataaagctcctggaagccattgag
aagaaaggactggaatgttcaactctatacagaacacagagctccagcaaccctgcagag
ttacgacagcttcttgattgtgatcccccctcagtggacttggatgtgttcgatgaacac
gttttagcagatgctttcaaacgctatctcgccgacttaccaaatcctgtcattccagta
gctgtttacaatgagatgatgtctttagcccaagaagtaccaagctccgaagactacatc
cagctgttgaagaagctcattaggtcgcctaatatacctcatcagtattggcttacgctc
cagtatttgctcaagcacttcttcaagctctctcaagcctccagcaagaaccttctgaat
gcaagagccctctctgaaattttcagccacgtgcttttcagattcccagcagccagctct
gataatactgaacacctcataaaagcggtagagcttttaatctcagcggagtggagtgag
cgacagccagcaccagcactgccccctaaaccacccaagcccacttctatagccaacaac
agcatgaacaacaatatgtccttacaggatgctgaatggtactggggagatatctcaagg
gaagaagtaaatgaaaaactccgagacactgctgatgggacctttctggtacgagatgca
tccactaaaatgcacggngactacactctcacactaaggaaaggaggaaataacaaatta
atcaaaatctttcaccgagatgggaaatacggtttctctgatccattaaccttcaactct
gtggttgaattaataaaccactaccggaatgagtccttagctcagtacaatcccaagctg
gatgtgaagttactctacccagtgtctaaataccagcaggatcaagttgtcaaagaagat
aatattgaagctgtggggaaaaaattacatgaatataatactcaatttcaagaaaaaagt
cgggaatatgatagattatatgaggaatacactcgtacttcccaggaaatacagatgaaa
agaacagctatcgaagcatttaatgacaccataaaaatattcgaagagcagtgccacccc
caggagcggtacagcaaagactacatagagaagtttaaacgcgaaggcaacgagaaggaa
attcaaaggataatgcataatcacgataagctgaagtctcggatcagcgagatcatcgac
agcaggaggagactggaggaagacttgaagaagcaggcagccgagtatcgcgagatcgac
aagcgcatgaatagcattaagccggacctcattcagctgagaaagacaagagatcaatac
ttgatgtggctgacgcagaaaggggtccggcagaagaagctgaacgaatggttgggaaac
gaaaacacagaagaccaatactcactggtagacgatgacgaggatttgccccaccatgat
gagaagacgtggaatgtggggagcagcaaccgaaacaaagccgagaacctattgcgaggg
aaacgagatggcactttcctggtccgggagagcagtaagcagggctgctatgcctgctct
gtagtggtagatggcgaagtcaaacattgcgtcatcaacaagactgccaccggctatggc
ttcgccgagccctacaacctgtacagctccctgaaagagctggtgctacattaccaacac
acctccctggtgcagcacaatgactccctcaatgtcacactagcatacccagtatatgca
caacagaggcgatga

KEGG   Rattus norvegicus (rat): 29741
Entry
29741             CDS       T01003                                 

Gene name
Pik3r2
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno01524  Platinum drug resistance
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04066  HIF-1 signaling pathway
rno04068  FoxO signaling pathway
rno04070  Phosphatidylinositol signaling system
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04210  Apoptosis
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04218  Cellular senescence
rno04360  Axon guidance
rno04370  VEGF signaling pathway
rno04380  Osteoclast differentiation
rno04510  Focal adhesion
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno04620  Toll-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04630  JAK-STAT signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04668  TNF signaling pathway
rno04670  Leukocyte transendothelial migration
rno04722  Neurotrophin signaling pathway
rno04725  Cholinergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04810  Regulation of actin cytoskeleton
rno04910  Insulin signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04915  Estrogen signaling pathway
rno04917  Prolactin signaling pathway
rno04919  Thyroid hormone signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04926  Relaxin signaling pathway
rno04929  GnRH secretion
rno04930  Type II diabetes mellitus
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04935  Growth hormone synthesis, secretion and action
rno04960  Aldosterone-regulated sodium reabsorption
rno04973  Carbohydrate digestion and absorption
rno05010  Alzheimer disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05100  Bacterial invasion of epithelial cells
rno05135  Yersinia infection
rno05142  Chagas disease
rno05146  Amoebiasis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05207  Chemical carcinogenesis - receptor activation
rno05210  Colorectal cancer
rno05211  Renal cell carcinoma
rno05212  Pancreatic cancer
rno05213  Endometrial cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05218  Melanoma
rno05220  Chronic myeloid leukemia
rno05221  Acute myeloid leukemia
rno05222  Small cell lung cancer
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05230  Central carbon metabolism in cancer
rno05231  Choline metabolism in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05415  Diabetic cardiomyopathy
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    29741 (Pik3r2)
   04014 Ras signaling pathway
    29741 (Pik3r2)
   04015 Rap1 signaling pathway
    29741 (Pik3r2)
   04370 VEGF signaling pathway
    29741 (Pik3r2)
   04630 JAK-STAT signaling pathway
    29741 (Pik3r2)
   04668 TNF signaling pathway
    29741 (Pik3r2)
   04066 HIF-1 signaling pathway
    29741 (Pik3r2)
   04068 FoxO signaling pathway
    29741 (Pik3r2)
   04070 Phosphatidylinositol signaling system
    29741 (Pik3r2)
   04072 Phospholipase D signaling pathway
    29741 (Pik3r2)
   04071 Sphingolipid signaling pathway
    29741 (Pik3r2)
   04024 cAMP signaling pathway
    29741 (Pik3r2)
   04151 PI3K-Akt signaling pathway
    29741 (Pik3r2)
   04152 AMPK signaling pathway
    29741 (Pik3r2)
   04150 mTOR signaling pathway
    29741 (Pik3r2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    29741 (Pik3r2)
  09143 Cell growth and death
   04210 Apoptosis
    29741 (Pik3r2)
   04218 Cellular senescence
    29741 (Pik3r2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    29741 (Pik3r2)
   04550 Signaling pathways regulating pluripotency of stem cells
    29741 (Pik3r2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    29741 (Pik3r2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    29741 (Pik3r2)
   04613 Neutrophil extracellular trap formation
    29741 (Pik3r2)
   04620 Toll-like receptor signaling pathway
    29741 (Pik3r2)
   04625 C-type lectin receptor signaling pathway
    29741 (Pik3r2)
   04650 Natural killer cell mediated cytotoxicity
    29741 (Pik3r2)
   04660 T cell receptor signaling pathway
    29741 (Pik3r2)
   04662 B cell receptor signaling pathway
    29741 (Pik3r2)
   04664 Fc epsilon RI signaling pathway
    29741 (Pik3r2)
   04666 Fc gamma R-mediated phagocytosis
    29741 (Pik3r2)
   04670 Leukocyte transendothelial migration
    29741 (Pik3r2)
   04062 Chemokine signaling pathway
    29741 (Pik3r2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    29741 (Pik3r2)
   04923 Regulation of lipolysis in adipocytes
    29741 (Pik3r2)
   04929 GnRH secretion
    29741 (Pik3r2)
   04915 Estrogen signaling pathway
    29741 (Pik3r2)
   04914 Progesterone-mediated oocyte maturation
    29741 (Pik3r2)
   04917 Prolactin signaling pathway
    29741 (Pik3r2)
   04926 Relaxin signaling pathway
    29741 (Pik3r2)
   04935 Growth hormone synthesis, secretion and action
    29741 (Pik3r2)
   04919 Thyroid hormone signaling pathway
    29741 (Pik3r2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    29741 (Pik3r2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    29741 (Pik3r2)
  09156 Nervous system
   04725 Cholinergic synapse
    29741 (Pik3r2)
   04722 Neurotrophin signaling pathway
    29741 (Pik3r2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    29741 (Pik3r2)
  09158 Development and regeneration
   04360 Axon guidance
    29741 (Pik3r2)
   04380 Osteoclast differentiation
    29741 (Pik3r2)
  09149 Aging
   04211 Longevity regulating pathway
    29741 (Pik3r2)
   04213 Longevity regulating pathway - multiple species
    29741 (Pik3r2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    29741 (Pik3r2)
   05206 MicroRNAs in cancer
    29741 (Pik3r2)
   05205 Proteoglycans in cancer
    29741 (Pik3r2)
   05207 Chemical carcinogenesis - receptor activation
    29741 (Pik3r2)
   05203 Viral carcinogenesis
    29741 (Pik3r2)
   05230 Central carbon metabolism in cancer
    29741 (Pik3r2)
   05231 Choline metabolism in cancer
    29741 (Pik3r2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    29741 (Pik3r2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    29741 (Pik3r2)
   05212 Pancreatic cancer
    29741 (Pik3r2)
   05225 Hepatocellular carcinoma
    29741 (Pik3r2)
   05226 Gastric cancer
    29741 (Pik3r2)
   05214 Glioma
    29741 (Pik3r2)
   05221 Acute myeloid leukemia
    29741 (Pik3r2)
   05220 Chronic myeloid leukemia
    29741 (Pik3r2)
   05218 Melanoma
    29741 (Pik3r2)
   05211 Renal cell carcinoma
    29741 (Pik3r2)
   05215 Prostate cancer
    29741 (Pik3r2)
   05213 Endometrial cancer
    29741 (Pik3r2)
   05224 Breast cancer
    29741 (Pik3r2)
   05222 Small cell lung cancer
    29741 (Pik3r2)
   05223 Non-small cell lung cancer
    29741 (Pik3r2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    29741 (Pik3r2)
   05170 Human immunodeficiency virus 1 infection
    29741 (Pik3r2)
   05161 Hepatitis B
    29741 (Pik3r2)
   05160 Hepatitis C
    29741 (Pik3r2)
   05171 Coronavirus disease - COVID-19
    29741 (Pik3r2)
   05164 Influenza A
    29741 (Pik3r2)
   05162 Measles
    29741 (Pik3r2)
   05168 Herpes simplex virus 1 infection
    29741 (Pik3r2)
   05163 Human cytomegalovirus infection
    29741 (Pik3r2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    29741 (Pik3r2)
   05169 Epstein-Barr virus infection
    29741 (Pik3r2)
   05165 Human papillomavirus infection
    29741 (Pik3r2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    29741 (Pik3r2)
   05100 Bacterial invasion of epithelial cells
    29741 (Pik3r2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    29741 (Pik3r2)
   05142 Chagas disease
    29741 (Pik3r2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29741 (Pik3r2)
   05017 Spinocerebellar ataxia
    29741 (Pik3r2)
   05020 Prion disease
    29741 (Pik3r2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    29741 (Pik3r2)
   05418 Fluid shear stress and atherosclerosis
    29741 (Pik3r2)
   05415 Diabetic cardiomyopathy
    29741 (Pik3r2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    29741 (Pik3r2)
   04932 Non-alcoholic fatty liver disease
    29741 (Pik3r2)
   04931 Insulin resistance
    29741 (Pik3r2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    29741 (Pik3r2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    29741 (Pik3r2)
   01524 Platinum drug resistance
    29741 (Pik3r2)
   01522 Endocrine resistance
    29741 (Pik3r2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    29741 (Pik3r2)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    29741 (Pik3r2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_9 SH3_1 Ribosomal_L22e ATG11 Mod_r
Other DBs
NCBI-GeneID: 29741
NCBI-ProteinID: NP_071521
RGD: 68341
Ensembl: ENSRNOG00000019228
UniProt: Q5FVS6
Position
16
AA seq 722 aa
MAGAEGFQYRAVYPFRRERPEDLELLPGDLLVVSRVALQALGVADGGERCPHNVGWMPGF
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPLDGPSESGHTLASLAEQFSP
PEPAPPILVKLIEAIEQAELDSECYSRPELPAPRTDWSLSDLEQWDRTTLYDAVKGFLLA
LPAAVVTPEAASEAYRAMREVTGPVGLVLEPPTLPLHQALTLQFLLQHLGRVARRAPSPA
TAVHALASAFGPLLLRAPPPGGEGDGSEPAPDFPVLLLERLVQEHVDEQDTAPPALPPKP
SKVKPAPTALANGGSTPSLQDAEWYWGDISREEVNERLRDTPDGTFLVRDASSKIQGEYT
LTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVELISHYRHESLAQYNAKLDTRLLYPVS
KYQQDQVVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIEAFNE
TIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKLEQDL
RAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQRKINEWLGIKNETEDQYS
LMEDEDALPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVVVDGDTK
HCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPGPGPPPA
AR
NT seq 2169 nt   +upstreamnt  +downstreamnt
atggcaggtgctgaaggcttccagtacagggctgtatacccattccgccgggagcggcct
gaggacctggagcttcttcctggtgacctcctggtggtgagccgggtggctctgcaggca
ctaggtgtggctgatggaggagagcgctgcccacacaacgtgggctggatgcctggcttc
aatgagcgcacccgacagcgaggggacttccctggaacatatgtggagttcctaggacct
gtggctctggctcgaccaggccctcgcccacgggggccccgtccgttgcctgccaggccc
ttggatggaccttctgagtcaggtcacacactggcaagcctggcagagcagttctcccca
cctgagcctgcgcccccgattctggtgaagctgatagaagccattgagcaagcagagctg
gacagtgaatgctacagtaggccggagctgcccgcaccacggacagactggtccctgagt
gacttggagcagtgggaccgcaccaccttgtacgatgctgttaagggcttcctgctggca
ttgcctgcagctgtggtgactcctgaggctgcatcggaggcttatcgggcgatgcgggag
gttacggggcctgtggggctggtgctggaacccccaacgctgccgttgcaccaggccctc
actctgcagttcctgctgcagcacctgggccgcgtggcccgcagagcaccctcaccagct
acagctgtccacgcactggccagtgccttcgggccgctgctgctgcgtgcgcctccgcca
gggggcgagggtgatgggagtgagcctgcacctgacttccctgtgctgcttctagagagg
ctggtgcaggagcatgtggatgagcaagacaccgccccgccagcactgccacccaaaccc
tctaaggtaaagccggcacccacagccctggccaatggagggagtacaccctcgcttcag
gatgcagagtggtactggggggacatttccagggaagaggtgaatgagaggctccgagac
acacctgatggtaccttcttagtccgagatgcatccagcaagatccaaggagagtacacg
ctcaccctcaggaaaggcgggaacaacaagctaatcaaagtcttccaccgggacggtcac
tatggcttctcagagccccttaccttctgctccgtggtagagctcatctcccactaccga
catgagtcactggcccagtacaacgccaagctggacacgcgccttctctaccctgtgtcc
aagtaccagcaagaccaggtggtgaaggaggacagtgtagaggctgtgggtgcccagctc
aaggtctaccaccagcagtaccaggacaagagccgcgagtatgaccagctctatgaggaa
tacacacgaacctcccaggagcttcagatgaagcgcacagccatagaggccttcaacgag
accatcaagatcttcgaagaacagggccagacacaggaaaagtgcagcaaggagtatttg
gagcgcttccggcgagagggcaatgagaaggagatgcagaggatcctgctgaactcggag
cgactcaagtctcgaatcgcggagatacatgaaagccgcacgaagctggagcaggatctg
cgggcgcaggcctcggacaatcgagagattgacaagcgcatgaacagcctcaagcctgat
ctcatgcagctgcgcaagatcagggaccagtacctcgtgtggctcacccagaaaggtgcc
cgacagaggaagatcaacgagtggctgggaatcaagaatgagactgaggaccagtattca
ctgatggaggatgaggacgccctcccccaccatgaggagcgcacgtggtacgtgggcaag
atcaaccgcacacaggcggaggagatgctgagtggcaaacgagacgggaccttcctcatc
cgggagagcagccagcggggctgttacgcatgctctgtggtggtggatggcgacacgaag
cactgtgtcatctaccgcacagccactggctttggcttcgcagagccctataacctgtac
ggatccctgaaggagctggtattgcactaccagcacgcatcacttgtgcagcacaatgac
gcgctcaccgtcaccctcgcacaccctgtgcgtgcccccgggcctggcccgccccctgca
gcacgctga

KEGG   Rattus norvegicus (rat): 366508
Entry
366508            CDS       T01003                                 

Gene name
Pik3cd
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno01524  Platinum drug resistance
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04066  HIF-1 signaling pathway
rno04068  FoxO signaling pathway
rno04070  Phosphatidylinositol signaling system
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04210  Apoptosis
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04218  Cellular senescence
rno04360  Axon guidance
rno04370  VEGF signaling pathway
rno04380  Osteoclast differentiation
rno04510  Focal adhesion
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno04620  Toll-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04630  JAK-STAT signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04668  TNF signaling pathway
rno04670  Leukocyte transendothelial migration
rno04722  Neurotrophin signaling pathway
rno04725  Cholinergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04810  Regulation of actin cytoskeleton
rno04910  Insulin signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04915  Estrogen signaling pathway
rno04917  Prolactin signaling pathway
rno04919  Thyroid hormone signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04926  Relaxin signaling pathway
rno04929  GnRH secretion
rno04930  Type II diabetes mellitus
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04935  Growth hormone synthesis, secretion and action
rno04960  Aldosterone-regulated sodium reabsorption
rno04973  Carbohydrate digestion and absorption
rno05010  Alzheimer disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05100  Bacterial invasion of epithelial cells
rno05132  Salmonella infection
rno05135  Yersinia infection
rno05142  Chagas disease
rno05146  Amoebiasis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05207  Chemical carcinogenesis - receptor activation
rno05210  Colorectal cancer
rno05211  Renal cell carcinoma
rno05212  Pancreatic cancer
rno05213  Endometrial cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05218  Melanoma
rno05220  Chronic myeloid leukemia
rno05221  Acute myeloid leukemia
rno05222  Small cell lung cancer
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05230  Central carbon metabolism in cancer
rno05231  Choline metabolism in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05415  Diabetic cardiomyopathy
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    366508 (Pik3cd)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    366508 (Pik3cd)
   04014 Ras signaling pathway
    366508 (Pik3cd)
   04015 Rap1 signaling pathway
    366508 (Pik3cd)
   04370 VEGF signaling pathway
    366508 (Pik3cd)
   04630 JAK-STAT signaling pathway
    366508 (Pik3cd)
   04668 TNF signaling pathway
    366508 (Pik3cd)
   04066 HIF-1 signaling pathway
    366508 (Pik3cd)
   04068 FoxO signaling pathway
    366508 (Pik3cd)
   04070 Phosphatidylinositol signaling system
    366508 (Pik3cd)
   04072 Phospholipase D signaling pathway
    366508 (Pik3cd)
   04071 Sphingolipid signaling pathway
    366508 (Pik3cd)
   04024 cAMP signaling pathway
    366508 (Pik3cd)
   04151 PI3K-Akt signaling pathway
    366508 (Pik3cd)
   04152 AMPK signaling pathway
    366508 (Pik3cd)
   04150 mTOR signaling pathway
    366508 (Pik3cd)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    366508 (Pik3cd)
  09143 Cell growth and death
   04210 Apoptosis
    366508 (Pik3cd)
   04218 Cellular senescence
    366508 (Pik3cd)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    366508 (Pik3cd)
   04550 Signaling pathways regulating pluripotency of stem cells
    366508 (Pik3cd)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    366508 (Pik3cd)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    366508 (Pik3cd)
   04613 Neutrophil extracellular trap formation
    366508 (Pik3cd)
   04620 Toll-like receptor signaling pathway
    366508 (Pik3cd)
   04625 C-type lectin receptor signaling pathway
    366508 (Pik3cd)
   04650 Natural killer cell mediated cytotoxicity
    366508 (Pik3cd)
   04660 T cell receptor signaling pathway
    366508 (Pik3cd)
   04662 B cell receptor signaling pathway
    366508 (Pik3cd)
   04664 Fc epsilon RI signaling pathway
    366508 (Pik3cd)
   04666 Fc gamma R-mediated phagocytosis
    366508 (Pik3cd)
   04670 Leukocyte transendothelial migration
    366508 (Pik3cd)
   04062 Chemokine signaling pathway
    366508 (Pik3cd)
  09152 Endocrine system
   04910 Insulin signaling pathway
    366508 (Pik3cd)
   04923 Regulation of lipolysis in adipocytes
    366508 (Pik3cd)
   04929 GnRH secretion
    366508 (Pik3cd)
   04915 Estrogen signaling pathway
    366508 (Pik3cd)
   04914 Progesterone-mediated oocyte maturation
    366508 (Pik3cd)
   04917 Prolactin signaling pathway
    366508 (Pik3cd)
   04926 Relaxin signaling pathway
    366508 (Pik3cd)
   04935 Growth hormone synthesis, secretion and action
    366508 (Pik3cd)
   04919 Thyroid hormone signaling pathway
    366508 (Pik3cd)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    366508 (Pik3cd)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    366508 (Pik3cd)
  09156 Nervous system
   04725 Cholinergic synapse
    366508 (Pik3cd)
   04722 Neurotrophin signaling pathway
    366508 (Pik3cd)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    366508 (Pik3cd)
  09158 Development and regeneration
   04360 Axon guidance
    366508 (Pik3cd)
   04380 Osteoclast differentiation
    366508 (Pik3cd)
  09149 Aging
   04211 Longevity regulating pathway
    366508 (Pik3cd)
   04213 Longevity regulating pathway - multiple species
    366508 (Pik3cd)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    366508 (Pik3cd)
   05206 MicroRNAs in cancer
    366508 (Pik3cd)
   05205 Proteoglycans in cancer
    366508 (Pik3cd)
   05207 Chemical carcinogenesis - receptor activation
    366508 (Pik3cd)
   05203 Viral carcinogenesis
    366508 (Pik3cd)
   05230 Central carbon metabolism in cancer
    366508 (Pik3cd)
   05231 Choline metabolism in cancer
    366508 (Pik3cd)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    366508 (Pik3cd)
  09162 Cancer: specific types
   05210 Colorectal cancer
    366508 (Pik3cd)
   05212 Pancreatic cancer
    366508 (Pik3cd)
   05225 Hepatocellular carcinoma
    366508 (Pik3cd)
   05226 Gastric cancer
    366508 (Pik3cd)
   05214 Glioma
    366508 (Pik3cd)
   05221 Acute myeloid leukemia
    366508 (Pik3cd)
   05220 Chronic myeloid leukemia
    366508 (Pik3cd)
   05218 Melanoma
    366508 (Pik3cd)
   05211 Renal cell carcinoma
    366508 (Pik3cd)
   05215 Prostate cancer
    366508 (Pik3cd)
   05213 Endometrial cancer
    366508 (Pik3cd)
   05224 Breast cancer
    366508 (Pik3cd)
   05222 Small cell lung cancer
    366508 (Pik3cd)
   05223 Non-small cell lung cancer
    366508 (Pik3cd)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    366508 (Pik3cd)
   05170 Human immunodeficiency virus 1 infection
    366508 (Pik3cd)
   05161 Hepatitis B
    366508 (Pik3cd)
   05160 Hepatitis C
    366508 (Pik3cd)
   05171 Coronavirus disease - COVID-19
    366508 (Pik3cd)
   05164 Influenza A
    366508 (Pik3cd)
   05162 Measles
    366508 (Pik3cd)
   05168 Herpes simplex virus 1 infection
    366508 (Pik3cd)
   05163 Human cytomegalovirus infection
    366508 (Pik3cd)
   05167 Kaposi sarcoma-associated herpesvirus infection
    366508 (Pik3cd)
   05169 Epstein-Barr virus infection
    366508 (Pik3cd)
   05165 Human papillomavirus infection
    366508 (Pik3cd)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    366508 (Pik3cd)
   05135 Yersinia infection
    366508 (Pik3cd)
   05100 Bacterial invasion of epithelial cells
    366508 (Pik3cd)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    366508 (Pik3cd)
   05142 Chagas disease
    366508 (Pik3cd)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    366508 (Pik3cd)
   05017 Spinocerebellar ataxia
    366508 (Pik3cd)
   05020 Prion disease
    366508 (Pik3cd)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    366508 (Pik3cd)
   05418 Fluid shear stress and atherosclerosis
    366508 (Pik3cd)
   05415 Diabetic cardiomyopathy
    366508 (Pik3cd)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    366508 (Pik3cd)
   04932 Non-alcoholic fatty liver disease
    366508 (Pik3cd)
   04931 Insulin resistance
    366508 (Pik3cd)
   04933 AGE-RAGE signaling pathway in diabetic complications
    366508 (Pik3cd)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    366508 (Pik3cd)
   01524 Platinum drug resistance
    366508 (Pik3cd)
   01522 Endocrine resistance
    366508 (Pik3cd)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    366508 (Pik3cd)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     366508 (Pik3cd)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    366508 (Pik3cd)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DUF4135 DOCK-C2
Other DBs
NCBI-GeneID: 366508
NCBI-ProteinID: NP_001102448
RGD: 1310990
Ensembl: ENSRNOG00000016846
UniProt: D4A5Q1
Position
5
AA seq 944 aa
MPPGVDCPMEFWTKEESQSVAVDFLLPTGVYLNFPVSRNANLSTIKQVLWHRAQYEPFFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWLQYSFPLQLEPSARGWRA
GLLHVSNRPLLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFRQPLVERPEEYA
LQVNGRHEYLYGSYPLCHFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPR
VKPPPIPAKKPSSVSLWSLEQPFCIELIEGRKVNADERMKLVVQAGLFHGNEMLCKTVSS
SEVNVCSEPVWKQRLEFDISICDLPRMARLCFALYAVVEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGERCLYMWPSVPDEKGELMNPAGTVRGNPNTESAAALVIYLPEVAP
HPVYFPALEKILELGRHGERGRITEEEMLYLLCSWPELPVLSALELLDFSFPDCYVGSFA
IKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLGRALANRKIGHFLFWHLRSEMH
VPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKASSQKTTKPQTKEMMH
MCMRQETYMEALSHLQSPLDPSTLLEEVCVEQCTFMDSKMKPLWIMYSSEKAGGAGSVGI
IFKNGDDLRQDMLTLQMIQLMDFLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIAN
IQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHS
DNIMIRESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERF
RGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQTLWH
NT seq 2835 nt   +upstreamnt  +downstreamnt
atgccccctggggtagactgccccatggagttctggaccaaagaggagagccagagcgtg
gccgttgacttcttgctgcccacaggagtctacttgaacttccctgtgtcccgcaatgcc
aacctcagcaccatcaagcaggtgctgtggcatcgtgcacagtatgagccgttcttccac
atgctcagtgaccccgaggcttatgtgttcacctgtgtgaaccagacagcggagcagcag
gagttggaggatgagcagcggaggctgtgtgacatccagcccttcctgcccgtgctgcgc
ctggtggcccgagagggggaccgcgtgaagaagctcatcaactcacagatcagcctcctc
atcggcaaaggtctccatgagtttgattccctgcgggacccggaagtaaacgacttccgc
actaagatgcgccagttttgcgaagaggccgcggctcaccgccagcagctgggctgggtg
gaatggctgcagtatagcttccccctgcagctggagccctcagccagaggttggcgggct
ggcttattgcatgtcagcaaccgacccctgctggtcaatgtgaagttcgagggcagtgag
gagagcttcaccttccaggtatccaccaaggacatgcccctcgcactgatggcctgtgcc
ctccgaaaaaaggccaccgtgttccggcagcctctggtggagaggcctgaggagtatgcc
ctgcaggtgaacgggaggcacgagtacctctacggcagctaccccctctgccactttcag
tacatctgtagctgcctgcacagcggactgactccccatctgaccatggtccactcctcc
tccatcctcgccatgagggatgagcagagcaaccctgccccccaggtgcagaagccacga
gtcaaacctcccccgatccctgccaagaagccctcctctgtgtccctgtggtccctggaa
cagccattctgcattgagctgattgagggccgcaaggtgaatgcggatgaaaggatgaag
ctggttgtgcaggccgggctcttccacggcaatgagatgctgtgcaagactgtgtcgagc
tcagaggtgaatgtgtgctcagagcccgtgtggaagcagcgactagaattcgacatcagc
atctgtgacctcccccgaatggcccggctctgctttgcactctatgctgtcgtggagaag
gctaagaaggcgcgctccacaaagaagaagtccaagaaggcggactgtcccatcgcttgg
gccaacctcatgctattcgactacaaagatcagctcaagacgggcgaacggtgcctctac
atgtggccctctgtcccagatgagaaaggggaactgatgaatcctgcgggtacagtacgt
ggtaaccccaacacagagagtgccgctgccctggtcatctacctacctgaggtggctccc
caccctgtgtacttccctgctctggagaagatcctggagctggggcgtcacggggagcgt
gggcgcatcacagaggaggagatgctctatttgctgtgctcctggcccgagcttcctgtg
ctgagcgccctggagcttctggactttagttttcctgactgctacgtgggttccttcgcc
atcaagtccctacggaagctgacggatgacgagcttttccagtaccttctgcagctggta
caagtactcaaatatgagtcctacctggactgcgagttgaccaaattcttgttgggccga
gccctggctaaccgcaagatcgggcacttcctgttctggcacctccgctctgagatgcat
gtaccgtccgtggccctgcgttttggcctcatcatggaagcctactgcagaggcagcacc
caccacatgaaggtgctgatgaagcagggggaggcactgagcaagcttaaggccctgaat
gactttgtgaaggcgagctcgcagaagaccaccaagccccagaccaaggagatgatgcat
atgtgtatgcgccaggagacttacatggaggcgctgtcccacctgcagtctcccctcgac
cccagcaccctgctggaggaagtctgtgtggagcagtgcaccttcatggactccaaaatg
aagccattgtggatcatgtacagcagcgagaaggcaggcggtgccggcagcgtgggcatc
atctttaagaacggggatgacctccgccaggacatgctgactctgcagatgatccagctc
atggacttcctatggaagcaggagggcctggacctgaggatgaccccctatggctgcctc
cccaccggagatcgcacaggcctcattgaggtggtcctccactcggacaccatcgccaac
atccagctgaataaaagcaacatggcagccacggctgcgttcaacaaggacgctctgctc
aactggctcaagtctaagaaccctggggaggctctggatcgggccattgaggaattcacc
ctctcctgtgctggctactgtgtggccacatatgtgctgggcatcggtgaccggcacagc
gataacatcatgatcagagagagtgggcagcttttccacattgactttggccactttctg
gggaacttcaagaccaagttcgggatcaaccgggagcgtgtccccttcattctcacctac
gactttgtccacgtgatccagcaggggaagactaacaacagtgagaaatttgaaaggttc
cgaggctactgtgaacgagcctacaccatcctgcggcgtcacgggctgcttttccttcat
ctcttcgccctcatgcgcgcagcaggtctgcctgagcttagctgctccaaagacatccag
actctctggcactag

KEGG   Rattus norvegicus (rat): 60664
Entry
60664             CDS       T01003                                 

Gene name
Pik3r3
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno01524  Platinum drug resistance
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04066  HIF-1 signaling pathway
rno04068  FoxO signaling pathway
rno04070  Phosphatidylinositol signaling system
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04210  Apoptosis
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04218  Cellular senescence
rno04360  Axon guidance
rno04370  VEGF signaling pathway
rno04380  Osteoclast differentiation
rno04510  Focal adhesion
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno04620  Toll-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04630  JAK-STAT signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04668  TNF signaling pathway
rno04670  Leukocyte transendothelial migration
rno04722  Neurotrophin signaling pathway
rno04725  Cholinergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04810  Regulation of actin cytoskeleton
rno04910  Insulin signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04915  Estrogen signaling pathway
rno04917  Prolactin signaling pathway
rno04919  Thyroid hormone signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04926  Relaxin signaling pathway
rno04929  GnRH secretion
rno04930  Type II diabetes mellitus
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04935  Growth hormone synthesis, secretion and action
rno04960  Aldosterone-regulated sodium reabsorption
rno04973  Carbohydrate digestion and absorption
rno05010  Alzheimer disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05100  Bacterial invasion of epithelial cells
rno05135  Yersinia infection
rno05142  Chagas disease
rno05146  Amoebiasis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05207  Chemical carcinogenesis - receptor activation
rno05210  Colorectal cancer
rno05211  Renal cell carcinoma
rno05212  Pancreatic cancer
rno05213  Endometrial cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05218  Melanoma
rno05220  Chronic myeloid leukemia
rno05221  Acute myeloid leukemia
rno05222  Small cell lung cancer
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05230  Central carbon metabolism in cancer
rno05231  Choline metabolism in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05415  Diabetic cardiomyopathy
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    60664 (Pik3r3)
   04014 Ras signaling pathway
    60664 (Pik3r3)
   04015 Rap1 signaling pathway
    60664 (Pik3r3)
   04370 VEGF signaling pathway
    60664 (Pik3r3)
   04630 JAK-STAT signaling pathway
    60664 (Pik3r3)
   04668 TNF signaling pathway
    60664 (Pik3r3)
   04066 HIF-1 signaling pathway
    60664 (Pik3r3)
   04068 FoxO signaling pathway
    60664 (Pik3r3)
   04070 Phosphatidylinositol signaling system
    60664 (Pik3r3)
   04072 Phospholipase D signaling pathway
    60664 (Pik3r3)
   04071 Sphingolipid signaling pathway
    60664 (Pik3r3)
   04024 cAMP signaling pathway
    60664 (Pik3r3)
   04151 PI3K-Akt signaling pathway
    60664 (Pik3r3)
   04152 AMPK signaling pathway
    60664 (Pik3r3)
   04150 mTOR signaling pathway
    60664 (Pik3r3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    60664 (Pik3r3)
  09143 Cell growth and death
   04210 Apoptosis
    60664 (Pik3r3)
   04218 Cellular senescence
    60664 (Pik3r3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    60664 (Pik3r3)
   04550 Signaling pathways regulating pluripotency of stem cells
    60664 (Pik3r3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    60664 (Pik3r3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    60664 (Pik3r3)
   04613 Neutrophil extracellular trap formation
    60664 (Pik3r3)
   04620 Toll-like receptor signaling pathway
    60664 (Pik3r3)
   04625 C-type lectin receptor signaling pathway
    60664 (Pik3r3)
   04650 Natural killer cell mediated cytotoxicity
    60664 (Pik3r3)
   04660 T cell receptor signaling pathway
    60664 (Pik3r3)
   04662 B cell receptor signaling pathway
    60664 (Pik3r3)
   04664 Fc epsilon RI signaling pathway
    60664 (Pik3r3)
   04666 Fc gamma R-mediated phagocytosis
    60664 (Pik3r3)
   04670 Leukocyte transendothelial migration
    60664 (Pik3r3)
   04062 Chemokine signaling pathway
    60664 (Pik3r3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    60664 (Pik3r3)
   04923 Regulation of lipolysis in adipocytes
    60664 (Pik3r3)
   04929 GnRH secretion
    60664 (Pik3r3)
   04915 Estrogen signaling pathway
    60664 (Pik3r3)
   04914 Progesterone-mediated oocyte maturation
    60664 (Pik3r3)
   04917 Prolactin signaling pathway
    60664 (Pik3r3)
   04926 Relaxin signaling pathway
    60664 (Pik3r3)
   04935 Growth hormone synthesis, secretion and action
    60664 (Pik3r3)
   04919 Thyroid hormone signaling pathway
    60664 (Pik3r3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    60664 (Pik3r3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    60664 (Pik3r3)
  09156 Nervous system
   04725 Cholinergic synapse
    60664 (Pik3r3)
   04722 Neurotrophin signaling pathway
    60664 (Pik3r3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    60664 (Pik3r3)
  09158 Development and regeneration
   04360 Axon guidance
    60664 (Pik3r3)
   04380 Osteoclast differentiation
    60664 (Pik3r3)
  09149 Aging
   04211 Longevity regulating pathway
    60664 (Pik3r3)
   04213 Longevity regulating pathway - multiple species
    60664 (Pik3r3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    60664 (Pik3r3)
   05206 MicroRNAs in cancer
    60664 (Pik3r3)
   05205 Proteoglycans in cancer
    60664 (Pik3r3)
   05207 Chemical carcinogenesis - receptor activation
    60664 (Pik3r3)
   05203 Viral carcinogenesis
    60664 (Pik3r3)
   05230 Central carbon metabolism in cancer
    60664 (Pik3r3)
   05231 Choline metabolism in cancer
    60664 (Pik3r3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    60664 (Pik3r3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    60664 (Pik3r3)
   05212 Pancreatic cancer
    60664 (Pik3r3)
   05225 Hepatocellular carcinoma
    60664 (Pik3r3)
   05226 Gastric cancer
    60664 (Pik3r3)
   05214 Glioma
    60664 (Pik3r3)
   05221 Acute myeloid leukemia
    60664 (Pik3r3)
   05220 Chronic myeloid leukemia
    60664 (Pik3r3)
   05218 Melanoma
    60664 (Pik3r3)
   05211 Renal cell carcinoma
    60664 (Pik3r3)
   05215 Prostate cancer
    60664 (Pik3r3)
   05213 Endometrial cancer
    60664 (Pik3r3)
   05224 Breast cancer
    60664 (Pik3r3)
   05222 Small cell lung cancer
    60664 (Pik3r3)
   05223 Non-small cell lung cancer
    60664 (Pik3r3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    60664 (Pik3r3)
   05170 Human immunodeficiency virus 1 infection
    60664 (Pik3r3)
   05161 Hepatitis B
    60664 (Pik3r3)
   05160 Hepatitis C
    60664 (Pik3r3)
   05171 Coronavirus disease - COVID-19
    60664 (Pik3r3)
   05164 Influenza A
    60664 (Pik3r3)
   05162 Measles
    60664 (Pik3r3)
   05168 Herpes simplex virus 1 infection
    60664 (Pik3r3)
   05163 Human cytomegalovirus infection
    60664 (Pik3r3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    60664 (Pik3r3)
   05169 Epstein-Barr virus infection
    60664 (Pik3r3)
   05165 Human papillomavirus infection
    60664 (Pik3r3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    60664 (Pik3r3)
   05100 Bacterial invasion of epithelial cells
    60664 (Pik3r3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    60664 (Pik3r3)
   05142 Chagas disease
    60664 (Pik3r3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    60664 (Pik3r3)
   05017 Spinocerebellar ataxia
    60664 (Pik3r3)
   05020 Prion disease
    60664 (Pik3r3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    60664 (Pik3r3)
   05418 Fluid shear stress and atherosclerosis
    60664 (Pik3r3)
   05415 Diabetic cardiomyopathy
    60664 (Pik3r3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    60664 (Pik3r3)
   04932 Non-alcoholic fatty liver disease
    60664 (Pik3r3)
   04931 Insulin resistance
    60664 (Pik3r3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    60664 (Pik3r3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    60664 (Pik3r3)
   01524 Platinum drug resistance
    60664 (Pik3r3)
   01522 Endocrine resistance
    60664 (Pik3r3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    60664 (Pik3r3)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    60664 (Pik3r3)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Bap31_Bap29_C Transcrip_act Cupin_8 Fez1 Mod_r
Other DBs
NCBI-GeneID: 60664
NCBI-ProteinID: NP_071549
RGD: 621042
Ensembl: ENSRNOG00000000145
UniProt: Q63789
Position
5
AA seq 461 aa
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPVTSAVTNGMKDCFVSL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSEPLTFNSVVELINHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKN
LQEFHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKDY
IERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKVRLEQDLKKQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHRGVRQRRLNAWLGIKSEDTDGGYFINEDDESLPHYDEKTWFV
EDVNRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYGSLKELVLHYQQTSLVQHNDSLNVTLAYPVHAQMPSLCR
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgtacaatacggtgtggagtatggaccgcgatgacgcagactggagggaggtgatgatg
ccctattcgacagaactgatattttatattgaaatggatcctccagctcttccaccaaag
ccacctaagccagtgacgtcagcagttacaaacggaatgaaggactgtttcgtttctctt
caagatgcagagtggtactggggagacatttccagggaagaggtaaatgacaaattgcgg
gacatgccagacggtactttcttagttcgagatgcctcaacaaaaatgcagggagactat
acactgactttgaggaagggaggaaataataaattaataaagatctatcatcgggatggt
aaatatggcttttctgagcccctgacgtttaattctgtggtggagctcattaaccactat
caccatgaatctctcgctcagtacaatcccaaacttgatgtgaagctgatgtacccagtg
tccagataccaacaggatcagttggtaaaagaagataacattgatgcggtaggtaaaaac
ctgcaagaattccactctcagtaccaggagaagagtaaagagtacgataggctgtatgaa
gagtacaccaggacgtcacaggaaatacaaatgaagagaactgccattgaagcctttaat
gaaacgattaaaatatttgaggagcagtgtcatacccaagaacaacacagtaaagactat
attgagcggtttcgcagagaggggaatgagaaggagattgagcggattatgatgaattac
gataaattgaaatcccgtctgggtgagattcacgatagcaaagtgcgtcttgagcaggac
ttgaagaaacaagctttggacaaccgggaaatagataaaaaaatgaatagcatcaagcct
gacctgatccagctgcgtaagatccgagaccagcacctcgtatggctcaatcacagggga
gtgaggcagaggcgcctgaacgcctggctggggatcaagagtgaggacacagatggaggc
tattttatcaatgaggacgatgagagcctgccgcattatgatgagaagacctggtttgtg
gaggatgtgaaccgagtacaggcagaggacctgctttatgggaagccagacggtgcattc
ttaattcgtgagagtagcaagaaaggatgttacgcttgttctgtggttgcagacggggag
gtgaagcactgtgtcatctacagcactgctcgaggatatggctttgcagaaccctacaac
ctgtacggctcgctgaaggagctggtgctccactaccagcagacatccctggtccagcac
aacgactccctcaacgtcacgctcgcctaccctgtccacgcacagatgccctctctctgc
agataa

KEGG   Rattus norvegicus (rat): 85243
Entry
85243             CDS       T01003                                 

Gene name
Pik3cb
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno01524  Platinum drug resistance
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04066  HIF-1 signaling pathway
rno04068  FoxO signaling pathway
rno04070  Phosphatidylinositol signaling system
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04210  Apoptosis
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04218  Cellular senescence
rno04360  Axon guidance
rno04370  VEGF signaling pathway
rno04380  Osteoclast differentiation
rno04510  Focal adhesion
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno04620  Toll-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04630  JAK-STAT signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04668  TNF signaling pathway
rno04670  Leukocyte transendothelial migration
rno04722  Neurotrophin signaling pathway
rno04725  Cholinergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04810  Regulation of actin cytoskeleton
rno04910  Insulin signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04915  Estrogen signaling pathway
rno04917  Prolactin signaling pathway
rno04919  Thyroid hormone signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04926  Relaxin signaling pathway
rno04929  GnRH secretion
rno04930  Type II diabetes mellitus
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04935  Growth hormone synthesis, secretion and action
rno04960  Aldosterone-regulated sodium reabsorption
rno04973  Carbohydrate digestion and absorption
rno05010  Alzheimer disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05100  Bacterial invasion of epithelial cells
rno05132  Salmonella infection
rno05135  Yersinia infection
rno05142  Chagas disease
rno05146  Amoebiasis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05207  Chemical carcinogenesis - receptor activation
rno05210  Colorectal cancer
rno05211  Renal cell carcinoma
rno05212  Pancreatic cancer
rno05213  Endometrial cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05218  Melanoma
rno05220  Chronic myeloid leukemia
rno05221  Acute myeloid leukemia
rno05222  Small cell lung cancer
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05230  Central carbon metabolism in cancer
rno05231  Choline metabolism in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05415  Diabetic cardiomyopathy
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    85243 (Pik3cb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    85243 (Pik3cb)
   04014 Ras signaling pathway
    85243 (Pik3cb)
   04015 Rap1 signaling pathway
    85243 (Pik3cb)
   04370 VEGF signaling pathway
    85243 (Pik3cb)
   04630 JAK-STAT signaling pathway
    85243 (Pik3cb)
   04668 TNF signaling pathway
    85243 (Pik3cb)
   04066 HIF-1 signaling pathway
    85243 (Pik3cb)
   04068 FoxO signaling pathway
    85243 (Pik3cb)
   04070 Phosphatidylinositol signaling system
    85243 (Pik3cb)
   04072 Phospholipase D signaling pathway
    85243 (Pik3cb)
   04071 Sphingolipid signaling pathway
    85243 (Pik3cb)
   04024 cAMP signaling pathway
    85243 (Pik3cb)
   04151 PI3K-Akt signaling pathway
    85243 (Pik3cb)
   04152 AMPK signaling pathway
    85243 (Pik3cb)
   04150 mTOR signaling pathway
    85243 (Pik3cb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    85243 (Pik3cb)
  09143 Cell growth and death
   04210 Apoptosis
    85243 (Pik3cb)
   04218 Cellular senescence
    85243 (Pik3cb)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    85243 (Pik3cb)
   04550 Signaling pathways regulating pluripotency of stem cells
    85243 (Pik3cb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    85243 (Pik3cb)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    85243 (Pik3cb)
   04613 Neutrophil extracellular trap formation
    85243 (Pik3cb)
   04620 Toll-like receptor signaling pathway
    85243 (Pik3cb)
   04625 C-type lectin receptor signaling pathway
    85243 (Pik3cb)
   04650 Natural killer cell mediated cytotoxicity
    85243 (Pik3cb)
   04660 T cell receptor signaling pathway
    85243 (Pik3cb)
   04662 B cell receptor signaling pathway
    85243 (Pik3cb)
   04664 Fc epsilon RI signaling pathway
    85243 (Pik3cb)
   04666 Fc gamma R-mediated phagocytosis
    85243 (Pik3cb)
   04670 Leukocyte transendothelial migration
    85243 (Pik3cb)
   04062 Chemokine signaling pathway
    85243 (Pik3cb)
  09152 Endocrine system
   04910 Insulin signaling pathway
    85243 (Pik3cb)
   04923 Regulation of lipolysis in adipocytes
    85243 (Pik3cb)
   04929 GnRH secretion
    85243 (Pik3cb)
   04915 Estrogen signaling pathway
    85243 (Pik3cb)
   04914 Progesterone-mediated oocyte maturation
    85243 (Pik3cb)
   04917 Prolactin signaling pathway
    85243 (Pik3cb)
   04926 Relaxin signaling pathway
    85243 (Pik3cb)
   04935 Growth hormone synthesis, secretion and action
    85243 (Pik3cb)
   04919 Thyroid hormone signaling pathway
    85243 (Pik3cb)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    85243 (Pik3cb)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    85243 (Pik3cb)
  09156 Nervous system
   04725 Cholinergic synapse
    85243 (Pik3cb)
   04722 Neurotrophin signaling pathway
    85243 (Pik3cb)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    85243 (Pik3cb)
  09158 Development and regeneration
   04360 Axon guidance
    85243 (Pik3cb)
   04380 Osteoclast differentiation
    85243 (Pik3cb)
  09149 Aging
   04211 Longevity regulating pathway
    85243 (Pik3cb)
   04213 Longevity regulating pathway - multiple species
    85243 (Pik3cb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    85243 (Pik3cb)
   05206 MicroRNAs in cancer
    85243 (Pik3cb)
   05205 Proteoglycans in cancer
    85243 (Pik3cb)
   05207 Chemical carcinogenesis - receptor activation
    85243 (Pik3cb)
   05203 Viral carcinogenesis
    85243 (Pik3cb)
   05230 Central carbon metabolism in cancer
    85243 (Pik3cb)
   05231 Choline metabolism in cancer
    85243 (Pik3cb)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    85243 (Pik3cb)
  09162 Cancer: specific types
   05210 Colorectal cancer
    85243 (Pik3cb)
   05212 Pancreatic cancer
    85243 (Pik3cb)
   05225 Hepatocellular carcinoma
    85243 (Pik3cb)
   05226 Gastric cancer
    85243 (Pik3cb)
   05214 Glioma
    85243 (Pik3cb)
   05221 Acute myeloid leukemia
    85243 (Pik3cb)
   05220 Chronic myeloid leukemia
    85243 (Pik3cb)
   05218 Melanoma
    85243 (Pik3cb)
   05211 Renal cell carcinoma
    85243 (Pik3cb)
   05215 Prostate cancer
    85243 (Pik3cb)
   05213 Endometrial cancer
    85243 (Pik3cb)
   05224 Breast cancer
    85243 (Pik3cb)
   05222 Small cell lung cancer
    85243 (Pik3cb)
   05223 Non-small cell lung cancer
    85243 (Pik3cb)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    85243 (Pik3cb)
   05170 Human immunodeficiency virus 1 infection
    85243 (Pik3cb)
   05161 Hepatitis B
    85243 (Pik3cb)
   05160 Hepatitis C
    85243 (Pik3cb)
   05171 Coronavirus disease - COVID-19
    85243 (Pik3cb)
   05164 Influenza A
    85243 (Pik3cb)
   05162 Measles
    85243 (Pik3cb)
   05168 Herpes simplex virus 1 infection
    85243 (Pik3cb)
   05163 Human cytomegalovirus infection
    85243 (Pik3cb)
   05167 Kaposi sarcoma-associated herpesvirus infection
    85243 (Pik3cb)
   05169 Epstein-Barr virus infection
    85243 (Pik3cb)
   05165 Human papillomavirus infection
    85243 (Pik3cb)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    85243 (Pik3cb)
   05135 Yersinia infection
    85243 (Pik3cb)
   05100 Bacterial invasion of epithelial cells
    85243 (Pik3cb)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    85243 (Pik3cb)
   05142 Chagas disease
    85243 (Pik3cb)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    85243 (Pik3cb)
   05017 Spinocerebellar ataxia
    85243 (Pik3cb)
   05020 Prion disease
    85243 (Pik3cb)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    85243 (Pik3cb)
   05418 Fluid shear stress and atherosclerosis
    85243 (Pik3cb)
   05415 Diabetic cardiomyopathy
    85243 (Pik3cb)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    85243 (Pik3cb)
   04932 Non-alcoholic fatty liver disease
    85243 (Pik3cb)
   04931 Insulin resistance
    85243 (Pik3cb)
   04933 AGE-RAGE signaling pathway in diabetic complications
    85243 (Pik3cb)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    85243 (Pik3cb)
   01524 Platinum drug resistance
    85243 (Pik3cb)
   01522 Endocrine resistance
    85243 (Pik3cb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    85243 (Pik3cb)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     85243 (Pik3cb)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    85243 (Pik3cb)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C DUF4381
Other DBs
NCBI-GeneID: 85243
NCBI-ProteinID: NP_445933
RGD: 620917
Ensembl: ENSRNOG00000016384
UniProt: Q9Z1L0
Position
8
AA seq 1070 aa
MCFRSIMPPAMADTLDIWAVDSQIASDGSISVDFLLPTGIYIQLEVPREATISYIKQMLW
KQVHNYPMFNLLMDIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPAE
KLDSKIGVLIGKGLHEFDALKDPEVNEFRRKMRKFSEDKIQSLVGLSWIDWLKHTYPPEH
EPSVLENLEDKLYGGKLVVAVHFENSQDVFSFQVSPNLNPIKINELAIQKRLTIRGKEEE
ASPCDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFILVECCKIKKMYEQEMIAI
EAAINRNSSSLPLPLPPKKTRVISHVWGNNNPFQIVLVKGNKLNTEETVKVHVRAGLFHG
TELLCKTVVSSEISGKNDHIWNEQLEFDINICDLPRMARLCFAVYAVLDKVKTKKSTKTI
NPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRSGDVILHSWSSFPDELEEMLNPMGTVQ
TNPYAENATALHIKFPENKKQPYYYPPFDKIIEKAAEIASGDSANVSSRGGKKFLAVLKE
ILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALDNRRIGQFLFWHLRSEVHTPAVSIQFGVILEAYCRGSVGHMKVLSKQVEALNKLK
TLNSLIKLNAMKLNRAKGKEAMHTCLKQSAYREALSDLQSPLNPCVILSELYVEKCRYMD
SKMKPLWLVYSNRAFGEDAVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDRSGLIEVVSTSETIADIQLNSSNVAATAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgtgcttccgctctataatgcctcctgctatggcagacacccttgacatctgggccgtg
gattcacagatcgcgtctgatggctccatctctgtcgatttccttctgcccactgggatt
tatatccagttggaagtaccccgggaagctaccatttcttatattaaacagatgttatgg
aagcaagttcacaattacccaatgtttaacctccttatggacattgactcctatatgttt
gcctgtgtgaatcaaactgccgtatatgaggaacttgaagatgaaacacgaagactttgt
gatgtcagacctttccttccagttctcaaactagtgactagaagctgtgacccagcagaa
aaattggactcaaaaattggagttcttataggaaaaggtcttcatgaatttgatgccttg
aaggatcctgaagtgaatgaatttagaagaaaaatgcgcaagttcagcgaggacaagatt
cagtctctggtggggctgtcttggattgactggctcaagcacacgtacccgcccgagcac
gaaccgtccgtcctggagaacctggaagacaaactttatggagggaagctggttgtggct
gtgcattttgaaaatagccaggatgtatttagttttcaagtgtctcccaatttgaatcct
ataaaaataaatgaattggcaatccagaaacgcctcactattcgcgggaaggaagaggaa
gctagcccctgtgactatgtgttacaggtcagtgggagagtggagtatgtgtttggtgac
catccactgattcagttccagtatatccggaattgtgtaatgaacaggaccctgccccat
ttcatccttgtggaatgttgtaagatcaagaaaatgtatgaacaagaaatgattgccata
gaggctgccatcaaccgaaactcctccagccttcctctccctttaccaccaaagaaaaca
cgagttatttctcatgtctggggcaacaacaaccctttccaaattgtcttggtaaaagga
aataagcttaacacagaagaaaccgtgaaagttcatgtcagagccggactttttcatgga
accgagctcctgtgtaaaaccgtcgtaagctcagagatatcaggaaagaatgaccatatt
tggaatgaacaactggaatttgatattaatatttgtgacttaccaagaatggctcgatta
tgttttgctgtttacgcagttttggataaagtaaaaacgaagaaatcaacaaaaactatt
aatccctctaaatatcagaccatcaggaaagcaggaaaagtgcattatcctgttgcatgg
gtaaacaccatggtttttgacttcaaaggacagctgaggtctggagacgtaatattgcac
agctggtcttcgtttcctgatgagctggaagaaatgctgaaccccatggggactgtgcag
acgaacccatatgctgagaatgcaactgccttgcacattaagtttccggagaacaagaag
cagccttattattacccccccttcgataagatcattgagaaggcagctgagattgccagt
ggagacagtgcgaacgtatcaagtcgtggtgggaaaaagtttcttgctgtactgaaagaa
atcttggacagggaccccctgtctcagctgtgtgagaacgaaatggaccttatttggact
ctacggcaagactgccgagaaaatttcccacagtcactgccaaaactactcctgtcaatc
aaatggaataaacttgaagatgttgctcagcttcaggcgctcctgcagatttggcccaaa
ctgccacccagggaagcactggaactcctggatttcaactatccagaccagtatgtccga
gagtacgctgtaggctgcctgcgacagatgagtgatgaagaactctctcagtatctttta
cagttggtgcaagttttgaagtacgagccttttcttgactgtgccctctccagattccta
ttggaaagagcacttgacaaccggaggattggccagtttctgttttggcatcttaggtca
gaggtgcacactcctgctgtgtccattcagtttggtgtcatcctagaggcatactgtcgg
ggaagcgtggggcacatgaaagtgctttccaaacaggttgaagcactcaataaattaaaa
actttaaatagcttaatcaaattgaatgcgatgaagctgaacagagctaaaggaaaggag
gccatgcacacgtgcttaaaacagagtgcctaccgggaggcgctctctgacctgcagtca
cctctgaacccatgtgtcatcctctcagagctctatgtcgaaaagtgcagatacatggac
tccaagatgaagccgctgtggctggtctacagcaacagggcctttggagaggacgcggtg
ggagtgatcttcaaaaatggcgacgatttgcggcaggacatgctgaccctgcagatgctg
cgcctgatggatctgctgtggaaagaagctggcttggacctgcgaatgctcccctatggc
tgtctagcaacaggagatcgctctggcctcattgaggttgtgagcacctctgagacaatc
gctgacattcagctaaacagtagcaacgtggctgccacagcagccttcaacaaagatgct
ctcctgaactggctcaaggagtacaattctggggacgacctggacagagcgattgaggag
ttcaccctgtcctgtgctggctactgtgtagcctcttatgtccttggcattggtgacagg
cacagtgacaacatcatggtgaagaaaaccggccagctcttccacatagactttgggcat
attcttggaaatttcaaatctaaatttggcattaaaagggaacgagtaccttttattctt
acttatgacttcattcatgtcattcaacaaggaaaaacgggaaacacagaaaaatttggc
aggttccgccagtgctgtgaagacgcgtacctgattttacggcggcatgggaatctcttc
attaccctgtttgcgctgatgttgactgcagggcttcccgagctcacatcagtcaaagat
atacagtatcttaaggactctcttgccttaggaaagagtgaagaagaagcactcaaacag
tttaagcagaagtttgatgaggcactcagggaaagctggaccactaaggtgaactggatg
gctcatacagttcggaaagactacaggtcttag

DBGET integrated database retrieval system