KEGG   Rattus norvegicus (rat): 170922
Entry
170922            CDS       T01003                                 

Gene name
Ilk
Definition
(RefSeq) integrin-linked protein kinase
  KO
K06272  integrin-linked kinase [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03320  PPAR signaling pathway
rno04360  Axon guidance
rno04510  Focal adhesion
rno05100  Bacterial invasion of epithelial cells
rno05213  Endometrial cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    170922 (Ilk)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    170922 (Ilk)
  09158 Development and regeneration
   04360 Axon guidance
    170922 (Ilk)
 09160 Human Diseases
  09162 Cancer: specific types
   05213 Endometrial cancer
    170922 (Ilk)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    170922 (Ilk)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    170922 (Ilk)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    170922 (Ilk)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     170922 (Ilk)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: TKL group
  MLK family
   170922 (Ilk)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    170922 (Ilk)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ank_4 Pkinase Ank_5 Ank_2 Ank Ank_3
Other DBs
NCBI-GeneID: 170922
NCBI-ProteinID: NP_596900
RGD: 620063
Ensembl: ENSRNOG00000018993
UniProt: Q99J82
Position
1
AA seq 452 aa
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARI
NVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLV
ANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNG
TLNKHSGIDFKQLNFLAKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECP
RLRIFSHPNVLPVLGACQAPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALD
MARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEA
LQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPH
VCKLMKICMNEDPAKRPKFDMIVPILEKMQDK
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggacgacattttcactcagtgccgggagggcaacgcggtggcggtgcgcttgtggctg
gacaacacagagaacgacctaaatcagggggatgatcatggcttctcccctttgcactgg
gcctgccgagaaggccgatctgcagtggttgaaatgctgatcatgcggggagcacggatc
aatgtgatgaatcgtggggatgatacccccctgcacttggcagctagtcacggacaccgt
gacattgtacagaagctgttgcaatacaaggctgacatcaatgcagtgaatgaacatggg
aatgtgccccttcactatgcatgtttctggggccaagaccaggtggcagaggacctagta
gctaacggggctcttgtgagcatctgtaacaagtatggagagatgcctgtggacaaagcc
aaggcaccccttcgagagcttctccgagaacgggcagagaagatgggccagaatcttaat
cgtattccatacaaggacacattctggaaggggaccactcgcacaaggccccgaaatggg
accctgaacaaacactctggtattgacttcaaacagctcaactttctggcaaagctcaac
gagaatcattctggagagctatggaaaggccgctggcagggcaatgacattgttgtgaag
gtgctgaaggttcgagactggagtacaaggaaaagcagggacttcaatgaggaatgtccc
cggctcaggattttctctcatcctaacgtgcttccggtactaggtgcttgccaggctccc
ccagctccccacccaaccctcatcacacactggatgccatatggatctctctacaatgtt
ctacatgaaggcaccaatttcgttgtggaccagagccaagctgtaaagtttgctttggac
atggcaagaggcatggcttttcttcatacactagagcctctcatacctcggcacgcactc
aatagccgtagtgtaatgatcgatgaagatatgactgcccgaatcagcatggctgatgta
aagttttctttccagtgccctgggcgcatgtatgcacctgcctgggtggcccctgaagcc
ctgcaaaagaagcctgaagatacaaacagacgctcagcagacatgtggagttttgccgtg
cttctgtgggaactggtgacacgagaggtgccctttgctgacctttctaatatggagatt
ggaatgaaggtggcactggaaggccttcggcctactatcccaccaggtatttccccccac
gtgtgtaagctcatgaagatttgcatgaatgaagaccctgcaaagcgacccaagtttgac
atgattgtacctatcttggagaagatgcaggacaagtag

DBGET integrated database retrieval system