KEGG   Rattus norvegicus (rat): 171102
Entry
171102            CDS       T01003                                 

Gene name
Cdc25a
Definition
(RefSeq) M-phase inducer phosphatase 1
  KO
K06645  M-phase inducer phosphatase 1 [EC:3.1.3.48]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04218  Cellular senescence
rno04914  Progesterone-mediated oocyte maturation
rno05206  MicroRNAs in cancer
rno05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    171102 (Cdc25a)
   04218 Cellular senescence
    171102 (Cdc25a)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    171102 (Cdc25a)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    171102 (Cdc25a)
   05207 Chemical carcinogenesis - receptor activation
    171102 (Cdc25a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    171102 (Cdc25a)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    171102 (Cdc25a)
   03400 DNA repair and recombination proteins [BR:rno03400]
    171102 (Cdc25a)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     171102 (Cdc25a)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein tyrosine phosphatases (PTPs)
  Class III PTPs
   CDC25s
    171102 (Cdc25a)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     171102 (Cdc25a)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    171102 (Cdc25a)
Motif
Pfam: M-inducer_phosp Rhodanese
Other DBs
NCBI-GeneID: 171102
NCBI-ProteinID: NP_598255
RGD: 621498
Ensembl: ENSRNOG00000020737
UniProt: P48965
Position
8
AA seq 525 aa
MELGPEPPHRRRLLFTCSPTPAPQPTGKVLFGASAAGGLSPVTNLTVTMDQLEGLGSDYE
KPMDVRNSSSLQRMGSSESTDSGFCLDSPGPLDSKENLEISLRRINCLPQKLLGCSPALK
RSHSDSLDHDIFQLIDQDENKENEAFEFKKPIRPASRGCLNAHVHEESKDPFTHRQNSAP
ARMLSSNESDISESGNFSPLFTPQSPVKATLSDEDDGFIDLLDGENLKNDEETPSCMSSL
WTAPLVMRRPTNLADRCGLFDSPSPCSSTSSCSTRAVKRADRSHEESPRGTKRRKSSEAS
PVKADVPEPTQLPHQSLSLTSFPKGTIENILDSDPRDLIGDFSKGYLFHTVSGKHQDLKY
ISPEIMASVLNGKFANLIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEEFLLKKPIVP
ADGKRVIVVFHCEFSSERGPRMCRYVRERDRLGNEYPKLHYPELYVLKGGYKEFFLKCQS
HCEPPSYRPMHHEDFKEDLKKFRTKSRTWAGEKSKREMYSRLKKL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atggaactgggcccggagcccccccaccgccgccgcctgctcttcacttgcagccccact
cctgcgccgcagcccacggggaaggtgctgtttggcgcgtcagctgctggcggactgtcc
cctgtcaccaacctgacggtcaccatggaccagctggaagggctgggcagtgactatgag
aaaccaatggacgtgagaaatagcagcagtctacagagaatgggctcctctgaatcgact
gattcaggtttctgtctagattctcctgggcccttggacagtaaagaaaaccttgaaatt
tccctgaggagaataaattgcctacctcagaagctcttggggtgtagcccagcgctaaag
aggagccattctgattctctagaccacgacatctttcaactcattgaccaggatgaaaat
aaagaaaatgaagcatttgaatttaaaaagccaataagacctgcatctcgtggctgcctg
aatgctcacgttcacgaggaaagtaaggacccctttacacacaggcagaattcagcccca
gctcggatgctgtcttcaaatgaaagtgacattagtgaatcaggaaatttcagtcctctt
tttacaccccagtcacctgtgaaagccactttgtctgatgaggatgatggcttcatagac
cttctggatggagagaatctgaagaatgatgaggagaccccgtcgtgcatgtcaagcctc
tggaccgctccccttgtcatgagaagacctacaaaccttgccgatcgatgtggactgttt
gactccccttccccgtgcagctccaccagcagctgcagcactcgggcagtgaagagagca
gaccgatctcatgaggagtctcctcgaggtacaaagcggaggaagagcagtgaggccagt
ccagtgaaggcagatgttccggagccaacgcagcttccacaccagtctctctccctgaca
tctttccccaaaggaaccattgagaacattttggacagtgacccaagagaccttataggg
gatttctccaagggttacctctttcatacggtctctgggaagcatcaggatttgaaatat
atttctccagaaattatggcatctgttttgaatggcaagtttgccaatctcattaaagag
tttgttatcattgactgccgatacccatatgaatatgaaggagggcacatcaagggtgcc
gtgaacttgcacatggaagaagaggttgaggagttcttactcaagaaacctatcgtgccc
gctgacggcaagcgtgtcattgtcgtgttccactgtgagttctcctctgagagaggccct
cggatgtgccgatatgtacgggaacgagataggcttggcaatgaataccccaaactccat
taccctgagctgtatgtcctgaaggggggatacaaggagttctttttgaaatgccagtct
cactgtgaaccccccagctaccgaccgatgcaccatgaagactttaaagaagacctaaag
aagttccgcaccaagagccggacctgggcaggggagaagagcaaaagggagatgtacagt
cgcctgaagaagctttga

DBGET integrated database retrieval system