KEGG   Rattus norvegicus (rat): 171103
Entry
171103            CDS       T01003                                 

Symbol
Cdc25b
Name
(RefSeq) M-phase inducer phosphatase 2 isoform 1
  KO
K05866  M-phase inducer phosphatase 2 [EC:3.1.3.48]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04110  Cell cycle
rno04914  Progesterone-mediated oocyte maturation
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    171103 (Cdc25b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    171103 (Cdc25b)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    171103 (Cdc25b)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    171103 (Cdc25b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    171103 (Cdc25b)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    171103 (Cdc25b)
   03400 DNA repair and recombination proteins [BR:rno03400]
    171103 (Cdc25b)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     171103 (Cdc25b)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein tyrosine phosphatases (PTPs)
  Class III PTPs
   CDC25s
    171103 (Cdc25b)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Centriole replication proteins
     171103 (Cdc25b)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    171103 (Cdc25b)
SSDB
Motif
Pfam: M-inducer_phosp Rhodanese
Other DBs
NCBI-GeneID: 171103
NCBI-ProteinID: NP_598256
RGD: 621500
Ensembl: ENSRNOG00000021248
UniProt: P48966
Position
3
AA seq 575 aa
MEVPPQKSAPGSALSTARVLGGIQRPRHLSGFGFGSDGLLGSPERAASSSPVTTLTQTMY
NLAGLGSETPKTQVGSLSFQNRLTDLSLSRRTSECSLSSESSESSDAGLCMDSPSPMDPQ
TAERTFEQAIQAASRVIQNEQFTIKRFRSLPVRLLGHSPVLQNITNSQALDSWEKDEAGY
RAASSPGEDKENDGYIFKMPQKLPHSSSARALAEWASRREAFTQRPSSAPDLMCLTTDGK
MDVEEASPVAQSSSLTPVERACEEDDGFVDILESDLKDDDMVPAGMENLISAPLVKKLDK
EEEQDLIMFSKCQRLFRSPSMPCSVIRPILKRLERPHDRDVPVLSKRRKSGTPLEEQQLE
EPKARVFRSKSLCHEIESILDSDHRGLIGDYSKAFLLQTVDGKHQDLKYISPETMVALLT
GKFSNIVEKFVIVDCRYPYEYEGGHIKNAVNLPLEPDAETFLLKHPITPCNLDKRIILIF
HCEFSSERGPRMCRFIRERDRAANDYPSLYYPEMYILKGGYKEFFPQHPNFCEPQDYRPM
NHAAFRDELRNFRLKTRSWAGERSRRELCSRLQDQ
NT seq 1728 nt   +upstreamnt  +downstreamnt
atggaggtacccccgcagaagtctgcgccgggctcagctctcagtactgcccgcgtgctg
ggtggcattcagcggccgcgccacctctcaggctttgggtttgggtctgatggcttgctg
gggtctccagagcgtgcggcttcctcctctccggttaccactcttacccagaccatgtac
aacctcgcagggctcggcagcgagaccccaaaaactcaagtaggaagcctgtcgttccag
aacaggctgacagacctgtccctgtccagacgtacctctgagtgctccctgtcatctgag
tcctcagaatcttctgatgcaggtctctgcatggactcccctagccctatggacccacag
acagcagagcgcacgtttgaacaggccattcaggcagccagtcgggtcattcaaaatgag
caatttaccataaaacgcttccggtctttgccagtgaggctgctgggacatagtcctgtg
ctacagaacatcaccaactcccaagcactggacagctgggagaaagatgaagcaggctac
agagctgccagtagtcctggggaggacaaagagaacgatggatatatcttcaagatgcca
cagaagctccctcattccagctctgcccgagctttggcagagtgggccagccgcagagag
gcctttacccagaggcccagctcagcccctgacttgatgtgtcttaccactgacgggaag
atggacgtggaggaggcgagccctgtggcacagtcttcctccttgactcctgtcgaaagg
gcttgtgaagaagatgacggatttgtggacatcctagagagtgatttaaaggatgatgat
atggtccccgcaggcatggagaacctcattagtgctccactggtcaaaaagctggataag
gaagaggaacaggatctcatcatgttcagcaagtgccagcggcttttccgctctccatcc
atgccgtgcagtgtgatccggcccatcctcaagaggctagagcggccccacgacagggac
gtgcctgtcctgagcaagcgcaggaagagtgggacacccctggaagagcagcagcttgaa
gaacccaaggcccgggtcttccgctcaaagtccctgtgtcacgagattgagagcatcctg
gacagtgaccaccgtggcctgattggagattactctaaggccttcctcctgcagactgtg
gatggcaaacaccaagacctcaagtacatctcaccagaaactatggtggccctgttgaca
ggcaagttcagcaacatcgtggagaagtttgtaattgtggactgcagatacccctatgag
tatgaaggcgggcatatcaagaatgctgtgaacttgcccctggaaccggatgccgagacc
tttctgctgaagcatcccatcacgccttgtaacctggacaagagaatcatcctcattttc
cactgtgaattctcatctgagcgtggaccacggatgtgccgcttcatcagggaacgggac
cgtgcagctaacgactatcccagcctgtactaccctgagatgtacatcctcaaaggcggc
tacaaggagttcttcccgcagcatccgaacttttgtgagccccaggactaccgacccatg
aaccatgcagctttccgggatgagctgaggaacttccgcctcaagacacgcagctgggct
ggggaacggagcaggagggaactctgtagcaggctgcaagaccagtga

KEGG   Rattus norvegicus (rat): 307511
Entry
307511            CDS       T01003                                 

Symbol
Cdc25c
Name
(RefSeq) M-phase inducer phosphatase 3
  KO
K05867  M-phase inducer phosphatase 3 [EC:3.1.3.48]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04914  Progesterone-mediated oocyte maturation
rno05170  Human immunodeficiency virus 1 infection
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    307511 (Cdc25c)
   04114 Oocyte meiosis
    307511 (Cdc25c)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    307511 (Cdc25c)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    307511 (Cdc25c)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    307511 (Cdc25c)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    307511 (Cdc25c)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    307511 (Cdc25c)
   03400 DNA repair and recombination proteins [BR:rno03400]
    307511 (Cdc25c)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     307511 (Cdc25c)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     307511 (Cdc25c)
 Protein tyrosine phosphatases (PTPs)
  Class III PTPs
   CDC25s
    307511 (Cdc25c)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     307511 (Cdc25c)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    307511 (Cdc25c)
SSDB
Motif
Pfam: Rhodanese
Other DBs
NCBI-GeneID: 307511
NCBI-ProteinID: NP_001100866
RGD: 1311875
Ensembl: ENSRNOG00000024008
Position
18
AA seq 261 aa
MKNLGSPITTVPKLSKNLKLEDQEGISEDPMECSLEDQDAKGLSLKKTVPLCGMDAIELE
EEDSDSEHLTGDFSKACVLPTVPGKHQDLKYISPDTVAALLSGKFQSVIERFYIIDCRYP
YEYLGGHILGALNLYSQKELYEFFLKKPVVPEDTQKRVIIVFLCEFSSERGPRMCRSLRE
KDRALNQYPALYYPELYILRGGYRDFFPEYMELCEPQGYCPMLHQDHQAELLSWRSQSKA
QEGERQLREQIALLVKNVSPQ
NT seq 786 nt   +upstreamnt  +downstreamnt
atgaagaatctgggcagtcccattactacagttccaaaactgagtaaaaatctcaagcta
gaagaccaagaagggatttcagaagacccaatggagtgttccctggaagaccaagatgcc
aagggcttaagtctgaagaagacggtccctctctgtggcatggatgccattgagttggag
gaggaagattctgactcagagcatctgactggtgatttctcaaaggcgtgtgtactgcca
acggtgccagggaaacaccaggatctgaagtatatcagcccagatacagtggctgcattg
ctgtctgggaagttccagagtgtgatcgagaggttttatatcattgattgccgttatccg
tatgagtacctgggaggacacattctgggagccttaaacctgtacagtcagaaggaacta
tacgagttctttctgaagaagcctgttgtccctgaggacacccagaagagagtcatcatt
gtgttcctctgtgaattctcctcagagagaggcccacgaatgtgccgttctctgagagaa
aaagacagggctctgaaccagtatccagcattatactaccctgagctgtatatcctcaga
gggggctacagagatttctttccagaatatatggagctgtgtgaaccccagggctactgt
cctatgcttcaccaggaccaccaggccgagctgctgagctggcgcagccagagcaaagcc
caggaaggggagcggcagctgcgagaacagattgccctcctggtgaagaatgtgagccct
caatag

DBGET integrated database retrieval system