KEGG   Rattus norvegicus (rat): 171365
Entry
171365            CDS       T01003                                 

Symbol
Snrpb
Name
(RefSeq) small nuclear ribonucleoprotein-associated protein B
  KO
K11086  small nuclear ribonucleoprotein B and B'
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03040  Spliceosome
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    171365 (Snrpb)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    171365 (Snrpb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    171365 (Snrpb)
   03032 DNA replication proteins [BR:rno03032]
    171365 (Snrpb)
Spliceosome [BR:rno03041]
 Complex A
  U1 snRNP components
   Sm proteins
    171365 (Snrpb)
  U2 snRNP components
    171365 (Snrpb)
 Complex B
  U1 snRNP components
    171365 (Snrpb)
  U4/U6.U5 tri-snRNP components
    171365 (Snrpb)
 Complex C
  U2 snRNP components
    171365 (Snrpb)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     171365 (Snrpb)
SSDB
Motif
Pfam: LSM
Other DBs
NCBI-GeneID: 171365
NCBI-ProteinID: NP_599185
RGD: 621301
Ensembl: ENSRNOG00000006961
UniProt: P17136
Position
3
AA seq 231 aa
MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAE
REEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPM
PQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMG
RGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGLL
NT seq 696 nt   +upstreamnt  +downstreamnt
atgacggtgggcaagagcagcaagatgctgcagcacatcgactacaggatgaggtgcatc
ctgcaagatggccggatcttcatcgggaccttcaaagcttttgacaagcatatgaacttg
atcctctgtgactgtgatgagttcaggaagatcaagccaaagaactccaaacaagcagaa
agagaagagaagcgagtccttggtctggtgttgcttcgaggagagaacctggtctccatg
acagtagaaggacctcctcccaaagatactggcattgcccgagtgccacttgctggagct
gctggggggccaggcatcggcagggctgctggcagaggaatcccggcgggtgtgcccatg
ccccaggctcctgcagggcttgctggaccagtgcgaggtgttggagggccgtcccagcag
gtgatgaccccacaaggaagaggcactgtggcagctgctgcagctgcagccacagccagt
attgcaggagccccaactcagtacccacctggtcgtgggggtcctcctccacctatgggc
cgaggggcacctcctccaggtatgatgggcccacctcctggcatgaggcctcccatgggt
cccccaatggggatccctcctggccgaggaactccaatgggcatgccccctcctgggatg
cgacctcctcctccaggcatgcgaggtctgctttga

DBGET integrated database retrieval system