KEGG   Rattus norvegicus (rat): 171378
Entry
171378            CDS       T01003                                 

Gene name
Ppp3cc
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04114  Oocyte meiosis
rno04218  Cellular senescence
rno04310  Wnt signaling pathway
rno04360  Axon guidance
rno04370  VEGF signaling pathway
rno04380  Osteoclast differentiation
rno04625  C-type lectin receptor signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04720  Long-term potentiation
rno04724  Glutamatergic synapse
rno04728  Dopaminergic synapse
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04924  Renin secretion
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05031  Amphetamine addiction
rno05152  Tuberculosis
rno05163  Human cytomegalovirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    171378 (Ppp3cc)
   04310 Wnt signaling pathway
    171378 (Ppp3cc)
   04370 VEGF signaling pathway
    171378 (Ppp3cc)
   04020 Calcium signaling pathway
    171378 (Ppp3cc)
   04022 cGMP-PKG signaling pathway
    171378 (Ppp3cc)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    171378 (Ppp3cc)
   04218 Cellular senescence
    171378 (Ppp3cc)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    171378 (Ppp3cc)
   04650 Natural killer cell mediated cytotoxicity
    171378 (Ppp3cc)
   04660 T cell receptor signaling pathway
    171378 (Ppp3cc)
   04658 Th1 and Th2 cell differentiation
    171378 (Ppp3cc)
   04659 Th17 cell differentiation
    171378 (Ppp3cc)
   04662 B cell receptor signaling pathway
    171378 (Ppp3cc)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    171378 (Ppp3cc)
   04921 Oxytocin signaling pathway
    171378 (Ppp3cc)
   04924 Renin secretion
    171378 (Ppp3cc)
  09156 Nervous system
   04724 Glutamatergic synapse
    171378 (Ppp3cc)
   04728 Dopaminergic synapse
    171378 (Ppp3cc)
   04720 Long-term potentiation
    171378 (Ppp3cc)
  09158 Development and regeneration
   04360 Axon guidance
    171378 (Ppp3cc)
   04380 Osteoclast differentiation
    171378 (Ppp3cc)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    171378 (Ppp3cc)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    171378 (Ppp3cc)
   05170 Human immunodeficiency virus 1 infection
    171378 (Ppp3cc)
   05163 Human cytomegalovirus infection
    171378 (Ppp3cc)
   05167 Kaposi sarcoma-associated herpesvirus infection
    171378 (Ppp3cc)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    171378 (Ppp3cc)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    171378 (Ppp3cc)
   05014 Amyotrophic lateral sclerosis
    171378 (Ppp3cc)
   05020 Prion disease
    171378 (Ppp3cc)
   05022 Pathways of neurodegeneration - multiple diseases
    171378 (Ppp3cc)
  09165 Substance dependence
   05031 Amphetamine addiction
    171378 (Ppp3cc)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    171378 (Ppp3cc)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    171378 (Ppp3cc)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     171378 (Ppp3cc)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     171378 (Ppp3cc)
Motif
Pfam: Metallophos DUF5378
Other DBs
NCBI-GeneID: 171378
NCBI-ProteinID: NP_599194
RGD: 621616
Ensembl: ENSRNOG00000009745
UniProt: Q6AYJ0
Position
15
AA seq 506 aa
MSGRRPQFSTTERVIKAVPFPPTRRLTLKEVFENGKPKMDVLKNHLVKEGRVEEDVALKI
INDGAAILKQEKTMLEVEAPITVCGDVHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGY
FSIECVLYLWSLKINHPKTLFLLRGNHECRHLTEYFTFKQECRIKYSELVYEACMHTFDC
LPLAALLNQQFLCVHGGMSPEITCLDDIRKLDRFAEPPAFGPVCDLLWSDPLEDYGSEKT
LEHYTHNTVRGCSYFFSYPAVCEFLQNNSLLSIIRAHEAQDAGYRMYRKNQATGFPSLIT
IFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEM
LVNILNICSDEEMSLVEEEGATSVRKEVIRNKIRAIGKMARVFTVLREESENVLILKGLT
PTGTLPLGVLSGGKQTIETAKLQAAEEREAIRGFTIAHRIRSFEEARGLDRINERMPPRK
EASYHHDAGKTHPHPSKRSDHGKKAL
NT seq 1521 nt   +upstreamnt  +downstreamnt
atgtccgggaggcgccctcagttctccacgaccgagcgcgtcatcaaagctgtccccttt
cctccaacccgacggctaactttgaaggaagtatttgagaatgggaaacctaaaatggat
gttttgaaaaaccatttggtaaaagaaggccgggtagaagaggacgtagccttaaagata
atcaatgatggggctgccatcctgaagcaagagaagactatgctagaagtggaagctcca
atcacagtgtgtggtgatgttcatggacaattctttgacctgatgaagttgtttgaagtt
gggggatcacctagtaatactcgctacctcttcctgggtgactatgtggacagaggctat
ttcagtatagagtgtgtgctgtatctgtggagcttaaagattaaccatcctaaaacattg
tttctgcttcgagggaatcatgaatgcaggcatcttacagagtacttcaccttcaaacaa
gaatgtcggatcaagtattcagagctggtgtacgaagcgtgcatgcacactttcgactgt
cttcctcttgctgccctcttaaaccagcagtttctctgtgtacacggaggaatgtctcct
gaaattacttgtttagacgacattaggaaattagataggtttgctgaacctcctgcattt
gggccagtgtgcgatctgctttggtctgatcccttagaggattatggtagtgagaagacc
ctggagcactacacccacaacactgtccgaggctgctcctacttcttcagttaccctgca
gtttgtgaatttttacagaacaatagtttattatcaataatcagagcccatgaagcccag
gatgctgggtaccgaatgtacaggaagaaccaagcaactggctttccatcactcattaca
attttctctgcccccaattacctagatgtctataacaataaagctgcagtattgaaatat
gaaaacaatgtcatgaacatcaggcagttcaactgttctccacacccttactggctccca
aacttcatggatgttttcacatggtctttgccttttgttggagaaaaagtcacagagatg
ttggtcaatattctcaacatatgctcggatgaagaaatgtccttagtcgaagaggaagga
gccacttcagttcgaaaagaagtcatcaggaataaaatccgagccattgggaaaatggca
cgggtctttacagttcttcgggaagagagtgagaatgtgctgattctcaagggcctcact
cccacaggcacactcccactcggggtcctctctggaggaaagcagaccattgagactgcc
aaactacaagcagcagaggagcgggaagccatcagaggttttacaattgcacacaggatc
cgaagttttgaagaagcccgaggtctagaccgaattaatgagagaatgccaccccgaaaa
gaggcttcttatcaccatgatgcaggaaagacacacccacacccgtcaaaaaggagcgac
catggaaagaaagccctgtaa

KEGG   Rattus norvegicus (rat): 24674
Entry
24674             CDS       T01003                                 

Gene name
Ppp3ca
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04114  Oocyte meiosis
rno04218  Cellular senescence
rno04310  Wnt signaling pathway
rno04360  Axon guidance
rno04370  VEGF signaling pathway
rno04380  Osteoclast differentiation
rno04625  C-type lectin receptor signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04720  Long-term potentiation
rno04724  Glutamatergic synapse
rno04728  Dopaminergic synapse
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04924  Renin secretion
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05031  Amphetamine addiction
rno05152  Tuberculosis
rno05163  Human cytomegalovirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24674 (Ppp3ca)
   04310 Wnt signaling pathway
    24674 (Ppp3ca)
   04370 VEGF signaling pathway
    24674 (Ppp3ca)
   04020 Calcium signaling pathway
    24674 (Ppp3ca)
   04022 cGMP-PKG signaling pathway
    24674 (Ppp3ca)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    24674 (Ppp3ca)
   04218 Cellular senescence
    24674 (Ppp3ca)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    24674 (Ppp3ca)
   04650 Natural killer cell mediated cytotoxicity
    24674 (Ppp3ca)
   04660 T cell receptor signaling pathway
    24674 (Ppp3ca)
   04658 Th1 and Th2 cell differentiation
    24674 (Ppp3ca)
   04659 Th17 cell differentiation
    24674 (Ppp3ca)
   04662 B cell receptor signaling pathway
    24674 (Ppp3ca)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    24674 (Ppp3ca)
   04921 Oxytocin signaling pathway
    24674 (Ppp3ca)
   04924 Renin secretion
    24674 (Ppp3ca)
  09156 Nervous system
   04724 Glutamatergic synapse
    24674 (Ppp3ca)
   04728 Dopaminergic synapse
    24674 (Ppp3ca)
   04720 Long-term potentiation
    24674 (Ppp3ca)
  09158 Development and regeneration
   04360 Axon guidance
    24674 (Ppp3ca)
   04380 Osteoclast differentiation
    24674 (Ppp3ca)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    24674 (Ppp3ca)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    24674 (Ppp3ca)
   05170 Human immunodeficiency virus 1 infection
    24674 (Ppp3ca)
   05163 Human cytomegalovirus infection
    24674 (Ppp3ca)
   05167 Kaposi sarcoma-associated herpesvirus infection
    24674 (Ppp3ca)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    24674 (Ppp3ca)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    24674 (Ppp3ca)
   05014 Amyotrophic lateral sclerosis
    24674 (Ppp3ca)
   05020 Prion disease
    24674 (Ppp3ca)
   05022 Pathways of neurodegeneration - multiple diseases
    24674 (Ppp3ca)
  09165 Substance dependence
   05031 Amphetamine addiction
    24674 (Ppp3ca)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    24674 (Ppp3ca)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    24674 (Ppp3ca)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     24674 (Ppp3ca)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     24674 (Ppp3ca)
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 24674
NCBI-ProteinID: NP_058737
RGD: 3382
Ensembl: ENSRNOG00000009882
UniProt: P63329
Structure
PDB: 
4IL1

Position
2
AA seq 521 aa
MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESV
ALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYV
DRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMD
AFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFG
NEKTQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFP
SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESV
LTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRIN
ERMPPRRDAMPSDANLNSINKALASETNGTDSNGSNSSNIQ
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgtccgagcccaaggcgattgatcccaagttgtcgactaccgacagggtggtgaaagcc
gttccatttccgccaagtcaccggctgacagcaaaggaagtgtttgataacgatgggaag
cctcgtgtggatatcttaaaagcacatctcatgaaggaaggcaggctggaagaaagtgtc
gcgttgagaataataacagagggtgcttcgattctccgacaggaaaaaaacttgctggat
attgatgccccagtcacagtttgcggggacatccatggacaattctttgacttgatgaag
ctctttgaagtgggaggatctcctgccaacactcgctacctcttcttaggggactatgtt
gacagagggtacttcagtatcgaatgtgtgctgtatttgtgggccttgaaaattctttac
cccaaaacactgtttttacttcgtggaaaccatgaatgtaggcacctaacagagtatttc
acgtttaaacaagaatgtaaaataaagtattcagaacgcgtttatgacgcctgtatggat
gccttcgactgccttcccctggctgcgctgatgaaccaacaattcctgtgtgtacacggt
ggtttgtctccagagattaacactctagatgacatcagaaaattagaccgattcaaagaa
ccacctgcttatgggcctatgtgtgacatcttgtggtcagaccccctggaggactttgga
aatgagaagactcaggaacatttcactcacaacacagtcaggggttgttcgtacttctac
agttacccggctgtatgtgacttcctgcagcacaataatttgttgtccatactccgagcc
cacgaagcccaggacgcagggtaccgcatgtacaggaaaagccaaacaactggcttcccg
tctctaattacgatcttctcggcaccaaattacttagatgtgtacaataataaagctgca
gtgttgaagtacgagaacaacgtgatgaacatcaggcagttcaactgctccccccatccg
tactggctcccaaatttcatggatgttttcacctggtcgctgccatttgttggggagaaa
gtgactgagatgctggtaaacgtcctgaacatctgctcagatgatgaactggggtcagaa
gaagatggatttgacggagccacggctgcagcccggaaggaggtcatcaggaacaagatc
cgagcaataggcaaaatggccagagtattctcagttctcagagaagagagtgagagcgtt
ctaactctgaagggcctgaccccgactggcatgctccccagcggagtgctctctggcggg
aaacaaactctgcaaagcgctactgttgaggccattgaggctgatgaagccatcaaagga
ttctcaccacaacataagattaccagcttcgaggaggccaagggcttagaccgaattaac
gagaggatgccgcctcgcagagacgccatgccttccgacgccaaccttaactccatcaac
aaggctctcgcctcagagactaacggcacagacagcaacggcagtaatagcagcaatatt
cagtga

KEGG   Rattus norvegicus (rat): 24675
Entry
24675             CDS       T01003                                 

Gene name
Ppp3cb
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit beta isoform
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04114  Oocyte meiosis
rno04218  Cellular senescence
rno04310  Wnt signaling pathway
rno04360  Axon guidance
rno04370  VEGF signaling pathway
rno04380  Osteoclast differentiation
rno04625  C-type lectin receptor signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04720  Long-term potentiation
rno04724  Glutamatergic synapse
rno04728  Dopaminergic synapse
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04924  Renin secretion
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05031  Amphetamine addiction
rno05152  Tuberculosis
rno05163  Human cytomegalovirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24675 (Ppp3cb)
   04310 Wnt signaling pathway
    24675 (Ppp3cb)
   04370 VEGF signaling pathway
    24675 (Ppp3cb)
   04020 Calcium signaling pathway
    24675 (Ppp3cb)
   04022 cGMP-PKG signaling pathway
    24675 (Ppp3cb)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    24675 (Ppp3cb)
   04218 Cellular senescence
    24675 (Ppp3cb)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    24675 (Ppp3cb)
   04650 Natural killer cell mediated cytotoxicity
    24675 (Ppp3cb)
   04660 T cell receptor signaling pathway
    24675 (Ppp3cb)
   04658 Th1 and Th2 cell differentiation
    24675 (Ppp3cb)
   04659 Th17 cell differentiation
    24675 (Ppp3cb)
   04662 B cell receptor signaling pathway
    24675 (Ppp3cb)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    24675 (Ppp3cb)
   04921 Oxytocin signaling pathway
    24675 (Ppp3cb)
   04924 Renin secretion
    24675 (Ppp3cb)
  09156 Nervous system
   04724 Glutamatergic synapse
    24675 (Ppp3cb)
   04728 Dopaminergic synapse
    24675 (Ppp3cb)
   04720 Long-term potentiation
    24675 (Ppp3cb)
  09158 Development and regeneration
   04360 Axon guidance
    24675 (Ppp3cb)
   04380 Osteoclast differentiation
    24675 (Ppp3cb)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    24675 (Ppp3cb)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    24675 (Ppp3cb)
   05170 Human immunodeficiency virus 1 infection
    24675 (Ppp3cb)
   05163 Human cytomegalovirus infection
    24675 (Ppp3cb)
   05167 Kaposi sarcoma-associated herpesvirus infection
    24675 (Ppp3cb)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    24675 (Ppp3cb)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    24675 (Ppp3cb)
   05014 Amyotrophic lateral sclerosis
    24675 (Ppp3cb)
   05020 Prion disease
    24675 (Ppp3cb)
   05022 Pathways of neurodegeneration - multiple diseases
    24675 (Ppp3cb)
  09165 Substance dependence
   05031 Amphetamine addiction
    24675 (Ppp3cb)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    24675 (Ppp3cb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    24675 (Ppp3cb)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     24675 (Ppp3cb)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     24675 (Ppp3cb)
Motif
Pfam: Metallophos DUF5378
Other DBs
NCBI-GeneID: 24675
NCBI-ProteinID: NP_058738
RGD: 3383
Ensembl: ENSRNOG00000054782
UniProt: P20651
Position
15
AA seq 525 aa
MAAPEPARAAPPPPPPPPPPLGADRVVKAVPFPPTHRLTSEEVFDMDGIPRVDVLKNHLV
KEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANT
RYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYS
ERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLL
WSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMY
RKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFT
WSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDVGSAAARKEIIRNKIRAIGKMARVF
SVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGSSPPHRICSF
EEAKGLDRINERMPPRKDAVQQDGFNSLNTAHTTENHGTGNHSAQ
NT seq 1578 nt   +upstreamnt  +downstreamnt
atggccgccccggagccggcccgggccgcgccgccccctcccccgcccccgccgcccccc
ctcggggccgaccgcgtcgtcaaagccgttccttttcccccaactcaccggttgacatct
gaagaagtgtttgatatggatgggatacccagggttgatgttctgaagaaccatctggta
aaagaaggtcgggtagatgaagaaattgcactaagaattatcaatgagggtgctgccata
cttaggcgggagaaaaccatgatagaagtagaagctccaattacagtgtgtggtgacatc
catggccaattttttgatctgatgaaactttttgaagtaggaggatcacctgctaataca
cgatacctttttcttggtgattatgtggacagaggttattttagtatagagtgtgtcttg
tatttatgggtcttgaagattctatacccaagcacattattccttctgagaggcaaccat
gaatgcagacacctcactgagtattttacctttaagcaggaatgtaaaattaagtattca
gaaagggtctatgaagcttgtatggaggcttttgacagcttgccccttgctgcacttcta
aaccaacaatttctttgtgttcatggtggactttcaccagagatacacacactggatgat
attaggagattagatagatttaaagagccacctgcatttggaccaatgtgtgacttgctg
tggtctgatccttctgaagactttggaaatgaaaaatcacaagaacattttagtcataat
acggttcgaggatgttcttatttttataactatccagcagtgtgtgaatttttgcaaaac
aataatttgttatcgattattagagctcatgaagctcaagatgcaggctatagaatgtac
agaaaaagtcaaactacagggtttccttcattaataacaattttttcggcacctaattac
ttagatgtctacaataataaagctgctgtactaaagtatgagaacaatgtgatgaacatc
cgccagtttaactgttctccacatccttactggttgcccaattttatggatgtctttaca
tggtctttaccatttgttggagaaaaagtcacagagatgttggtaaatgttctcagtatt
tgctctgatgatgaactaatgacagaaggggaagaccagtttgatgtaggttcagctgca
gcccggaaagaaatcataagaaacaagatccgagcaattggcaagatggcaagagtcttc
tctgttctcagggaggagagtgaaagcgtgctgacactcaagggcctgactcccacaggg
atgttgcctagtggagtgttggctggaggacggcagaccttgcaaagtgccacagttgag
gctattgaggctgaaaaagcaatacgaggatcctctccaccacatagaatctgcagtttt
gaagaggcaaagggtttggataggatcaatgagagaatgccaccccggaaagatgctgtg
cagcaagatggtttcaattccctgaacaccgcacataccactgagaaccacgggactggc
aaccatagtgcccagtga

KEGG   Rattus norvegicus (rat): 29748
Entry
29748             CDS       T01003                                 

Gene name
Ppp3r1
Definition
(RefSeq) calcineurin subunit B type 1
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04114  Oocyte meiosis
rno04218  Cellular senescence
rno04310  Wnt signaling pathway
rno04360  Axon guidance
rno04370  VEGF signaling pathway
rno04380  Osteoclast differentiation
rno04625  C-type lectin receptor signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04720  Long-term potentiation
rno04724  Glutamatergic synapse
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04924  Renin secretion
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05031  Amphetamine addiction
rno05152  Tuberculosis
rno05163  Human cytomegalovirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    29748 (Ppp3r1)
   04310 Wnt signaling pathway
    29748 (Ppp3r1)
   04370 VEGF signaling pathway
    29748 (Ppp3r1)
   04020 Calcium signaling pathway
    29748 (Ppp3r1)
   04022 cGMP-PKG signaling pathway
    29748 (Ppp3r1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    29748 (Ppp3r1)
   04218 Cellular senescence
    29748 (Ppp3r1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    29748 (Ppp3r1)
   04650 Natural killer cell mediated cytotoxicity
    29748 (Ppp3r1)
   04660 T cell receptor signaling pathway
    29748 (Ppp3r1)
   04658 Th1 and Th2 cell differentiation
    29748 (Ppp3r1)
   04659 Th17 cell differentiation
    29748 (Ppp3r1)
   04662 B cell receptor signaling pathway
    29748 (Ppp3r1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    29748 (Ppp3r1)
   04921 Oxytocin signaling pathway
    29748 (Ppp3r1)
   04924 Renin secretion
    29748 (Ppp3r1)
  09156 Nervous system
   04724 Glutamatergic synapse
    29748 (Ppp3r1)
   04720 Long-term potentiation
    29748 (Ppp3r1)
  09158 Development and regeneration
   04360 Axon guidance
    29748 (Ppp3r1)
   04380 Osteoclast differentiation
    29748 (Ppp3r1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    29748 (Ppp3r1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    29748 (Ppp3r1)
   05170 Human immunodeficiency virus 1 infection
    29748 (Ppp3r1)
   05163 Human cytomegalovirus infection
    29748 (Ppp3r1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    29748 (Ppp3r1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    29748 (Ppp3r1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29748 (Ppp3r1)
   05014 Amyotrophic lateral sclerosis
    29748 (Ppp3r1)
   05020 Prion disease
    29748 (Ppp3r1)
   05022 Pathways of neurodegeneration - multiple diseases
    29748 (Ppp3r1)
  09165 Substance dependence
   05031 Amphetamine addiction
    29748 (Ppp3r1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    29748 (Ppp3r1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    29748 (Ppp3r1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     29748 (Ppp3r1)
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 29748
NCBI-ProteinID: NP_059005
RGD: 69230
Ensembl: ENSRNOG00000043210
Vega: OTTRNOG00000001399
UniProt: P63100
Position
14
AA seq 170 aa
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgggaaatgaggcgagttaccctttggaaatgtgctcacacttcgatgctgatgagatt
aaaaggctaggaaagagattcaagaagcttgacttggacaactctggttctttgagcgtg
gaggagttcatgtctctgcctgagttacaacagaaccctttagtacagcgggtcatagat
atattcgacacagacgggaatggagaagtggacttcaaagaattcattgaaggagtctct
cagttcagtgtcaaaggcgataaggaacagaagttgaggttcgctttccgtatctacgac
atggataaagacggctatatttccaatggagagctcttccaggtgttgaagatgatggtg
ggcaacaacctgaaagatacgcagttacagcagattgtagacaaaaccataataaacgca
gataaggacggggacgggagaatatcctttgaggagttctgtgctgttgtaggtggccta
gatatccacaaaaagatggtggtggatgtgtga

KEGG   Rattus norvegicus (rat): 29749
Entry
29749             CDS       T01003                                 

Gene name
Ppp3r2
Definition
(RefSeq) calcineurin subunit B type 2
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04114  Oocyte meiosis
rno04218  Cellular senescence
rno04310  Wnt signaling pathway
rno04360  Axon guidance
rno04370  VEGF signaling pathway
rno04380  Osteoclast differentiation
rno04625  C-type lectin receptor signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04720  Long-term potentiation
rno04724  Glutamatergic synapse
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04924  Renin secretion
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05031  Amphetamine addiction
rno05152  Tuberculosis
rno05163  Human cytomegalovirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    29749 (Ppp3r2)
   04310 Wnt signaling pathway
    29749 (Ppp3r2)
   04370 VEGF signaling pathway
    29749 (Ppp3r2)
   04020 Calcium signaling pathway
    29749 (Ppp3r2)
   04022 cGMP-PKG signaling pathway
    29749 (Ppp3r2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    29749 (Ppp3r2)
   04218 Cellular senescence
    29749 (Ppp3r2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    29749 (Ppp3r2)
   04650 Natural killer cell mediated cytotoxicity
    29749 (Ppp3r2)
   04660 T cell receptor signaling pathway
    29749 (Ppp3r2)
   04658 Th1 and Th2 cell differentiation
    29749 (Ppp3r2)
   04659 Th17 cell differentiation
    29749 (Ppp3r2)
   04662 B cell receptor signaling pathway
    29749 (Ppp3r2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    29749 (Ppp3r2)
   04921 Oxytocin signaling pathway
    29749 (Ppp3r2)
   04924 Renin secretion
    29749 (Ppp3r2)
  09156 Nervous system
   04724 Glutamatergic synapse
    29749 (Ppp3r2)
   04720 Long-term potentiation
    29749 (Ppp3r2)
  09158 Development and regeneration
   04360 Axon guidance
    29749 (Ppp3r2)
   04380 Osteoclast differentiation
    29749 (Ppp3r2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    29749 (Ppp3r2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    29749 (Ppp3r2)
   05170 Human immunodeficiency virus 1 infection
    29749 (Ppp3r2)
   05163 Human cytomegalovirus infection
    29749 (Ppp3r2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    29749 (Ppp3r2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    29749 (Ppp3r2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29749 (Ppp3r2)
   05014 Amyotrophic lateral sclerosis
    29749 (Ppp3r2)
   05020 Prion disease
    29749 (Ppp3r2)
   05022 Pathways of neurodegeneration - multiple diseases
    29749 (Ppp3r2)
  09165 Substance dependence
   05031 Amphetamine addiction
    29749 (Ppp3r2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    29749 (Ppp3r2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    29749 (Ppp3r2)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     29749 (Ppp3r2)
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 29749
NCBI-ProteinID: NP_067733
RGD: 69232
Ensembl: ENSRNOG00000005368
UniProt: P28470
Position
5
AA seq 176 aa
MGNEASYHSEMGTHFDHDEIKRLGRSFKKMDLDKSGSLSVDEFMSLPELQQNPLVGRVID
IFDTDGNGEVDFREFIVGTSQFSVKGDEEQKLRFAFRIYDMDNDGFISNGELFQVLKMMV
GNNLKDWQLQQLVDKSILVLDKDGDGRISFEEFRDVVRTMEIHKKLVVFVDHGQED
NT seq 531 nt   +upstreamnt  +downstreamnt
atgggaaatgaggccagttaccattctgagatgggcacccacttcgaccacgacgagatt
aaaaggctgggcagaagcttcaagaagatggacttggacaaatcgggctccctgagcgta
gacgagttcatgtcgctgcctgagctgcagcagaatccactggtgggccgagtgatcgac
atctttgacacagacggcaacggggaagtggacttccgcgagttcatcgtgggcacctcc
cagttcagcgtcaagggtgacgaagagcagaagctaaggttcgccttcagaatctatgac
atggataatgatggcttcatctccaacggggagctcttccaggtgcttaagatgatggtg
ggaaacaacctcaaggactggcagctgcagcagctggtggacaaaagcatcttggtcctg
gataaggatggtgatggccggatatcctttgaagagttccgtgatgtggtcagaaccatg
gagatccacaagaaattggtcgtgtttgtagatcacggtcaagaagactaa

DBGET integrated database retrieval system