KEGG   Rattus norvegicus (rat): 171525
Entry
171525            CDS       T01003                                 

Gene name
Polk
Definition
(RefSeq) DNA polymerase kappa
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03460  Fanconi anemia pathway
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05210  Colorectal cancer
rno05212  Pancreatic cancer
rno05213  Endometrial cancer
rno05214  Glioma
rno05216  Thyroid cancer
rno05217  Basal cell carcinoma
rno05218  Melanoma
rno05220  Chronic myeloid leukemia
rno05222  Small cell lung cancer
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    171525 (Polk)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    171525 (Polk)
   05202 Transcriptional misregulation in cancer
    171525 (Polk)
  09162 Cancer: specific types
   05210 Colorectal cancer
    171525 (Polk)
   05212 Pancreatic cancer
    171525 (Polk)
   05225 Hepatocellular carcinoma
    171525 (Polk)
   05226 Gastric cancer
    171525 (Polk)
   05214 Glioma
    171525 (Polk)
   05216 Thyroid cancer
    171525 (Polk)
   05220 Chronic myeloid leukemia
    171525 (Polk)
   05217 Basal cell carcinoma
    171525 (Polk)
   05218 Melanoma
    171525 (Polk)
   05213 Endometrial cancer
    171525 (Polk)
   05224 Breast cancer
    171525 (Polk)
   05222 Small cell lung cancer
    171525 (Polk)
   05223 Non-small cell lung cancer
    171525 (Polk)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    171525 (Polk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    171525 (Polk)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     171525 (Polk)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    171525 (Polk)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH ATP-cone
Other DBs
NCBI-GeneID: 171525
NCBI-ProteinID: NP_612525
RGD: 620058
Ensembl: ENSRNOG00000060626
UniProt: B2RYH3
Position
2
AA seq 851 aa
MDNTKEKNNFKDALLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQVN
QRIENMMQQKAQITSQQLRKAQLQVDRFAMGLERNRNLNNTIVHVDMDAFYAAVEMRDNP
ELKEKPIAVGSMSMLATSNYHARRFGVRAAMPGFIAKRLCPQLIIVPPNFDKYRAVSKEV
KEILAEYDPNFMAMSLDEAYLNITQHLQERQGWPEDKRRYFIKMGNCRKIDTPRQEADEL
TERERSISPLLFEDSPPDLQPQGSPFQLNSEEQNNPQIAQNPVVFGTSAEEVVKEIRFRI
EQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQIVPSRSAVMDFIKDLPIRKVSGIGKVT
EKMLLALGIVTCTELYQQRALLSLLFSESSWHYFLHVALGLGSTDLARDGERKSMSVERT
FSEINKTEEQYSLCQELCTELAHDLQKEGLKGRTVTIKLKNVDFEVKTRASTVPSAISTA
EDIFAVAKELLRTEVTAGSPQPLRLRLMGVRMSTFSNDDDRKHQQRSIIGFLQAGNQGLS
PTGCTADRTDKTELVKPLETSRKKSFFDKKRSERIPNCQDPPRCKIAGEQALQASEPSQA
LKKMSESFKTSENSNDPQTFICPVCFREQEGISLEAFNEHVDACLDGPSTSENSEMPSYS
HASSADIGQQAHRAVPLWEKRGHGDGEITSGDGADLTETEDRSPKAASMDAVGNNHSEGE
GYPDSQGKSCPLSPANETVSTLSREDSAQPCTDEVVTGRALVCPVCNLEQETSDLTLFNI
HVDICLNKGIIQELRNSEVNSVKQPKGSTRSTDRLQKASGKTKRAGRKTKGSTSKRTKPR
DPRHTLDGFFK
NT seq 2556 nt   +upstreamnt  +downstreamnt
atggataacacaaaggaaaagaacaacttcaaagacgcccttctgctccgcatgggacta
aatgataacaaggcaggcatggaagggttggataaggagaaaattaacaaaattatcatg
gaagccacaaaggggtccagattttatggaaatgaactcaagaaggagaagcaagtcaat
caacggattgaaaacatgatgcagcaaaaggcgcaaattaccagccagcaactaaggaag
gcccagctacaggttgacagatttgcgatgggattagaacggaaccggaatttgaacaac
accatagttcacgtggacatggatgctttctatgcggccgtagaaatgagggacaacccg
gaactgaaggagaagcccatcgctgtaggatccatgagcatgctggctacttcaaattac
cacgcaaggaggtttggggttcgcgcagccatgccaggatttattgccaagagactctgc
ccacaacttattatagtgcccccaaactttgacaagtatagagctgtgagtaaggaggtt
aaggagatactcgctgaatatgatcccaattttatggccatgagtctggacgaggcctac
ttgaatataacacagcacttacaggaaaggcaaggttggcctgaggacaaaagaagatat
ttcatcaaaatgggaaactgtagaaaaattgacacaccccggcaggaagctgatgagctg
actgagcgggagcgctccatctccccactgctttttgaagatagccctcctgatttgcaa
ccccaaggaagtcctttccaactgaactctgaagaacaaaacaatcctcaaatagcccaa
aatccagttgtttttggaacatcagctgaggaagtggtaaaggaaattcgcttcagaatt
gaacagaaaacaacgctaacagccagcgcaggcatcgcccctaatacaatgttagcaaaa
gtgtgcagtgataagaataaaccaaatggacagtaccagatcgtccccagcaggagcgca
gtgatggacttcatcaaggacttgcctattcgaaaggtttctggaataggaaaagttacg
gagaaaatgttgctggctctcgggattgttacttgcacagaactctaccaacagagagcg
ttgctttctctccttttctcggagtcatcctggcactattttcttcatgttgcactgggc
ctgggttcaacagacctggcgagggatggagaaaggaaaagtatgagcgttgaaaggaca
tttagtgagatcaataaaacagaggaacagtacagcttgtgccaagaactgtgcactgag
ctcgcccacgatctccagaaggaaggacttaagggcagaactgtcaccatcaagctgaag
aatgtggattttgaagtaaaaacccgcgcatctacagtaccgtccgccatttctactgca
gaggacatatttgccgttgccaaggagctgctaaggacagaagtcactgcaggctctcca
cagcccctgcggctaagactgatgggtgttcggatgtctactttctccaacgacgatgac
aggaagcaccaacaaaggagcatcattggcttcttacaagctggaaaccaaggtttgtca
cccactgggtgtactgcagacagaactgacaaaactgagctcgtaaagcccttagaaacg
tctcgtaagaagagtttctttgataaaaagcgatcagaaaggatcccgaactgtcaagac
ccacccagatgtaaaatcgcgggtgagcaagctttacaggcctcggaaccatcccaagcg
ttgaagaagatgagcgagagtttcaaaacctcagagaattcaaatgaccctcagacattt
atatgtccagtttgctttagggagcaagaaggcatcagtctggaagcctttaatgaacat
gtagatgcatgtctcgatggaccgtccaccagtgagaactcagagatgcccagttactca
catgcttcgtctgcggacattggtcagcaggcacaccgtgctgttccactgtgggagaaa
cgggggcatggagatggagagatcacctcaggagatggtgcagatctaacagagactgaa
gacagatcgccgaaagcagcaagcatggacgctgtagggaataatcacagcgaaggggag
ggatatcctgatagtcagggcaagtcctgccctctgtcacccgcaaacgaaactgtcagc
acgttaagtagggaagactctgcccagccctgtacagatgaggtagtgacaggacgagct
ctagtttgtcccgtttgtaacctagaacaagagacgtctgatctcaccctcttcaacatc
cacgtggacatttgcttaaataaaggcatcatccaagaactgagaaacagcgaagttaat
tcagttaagcaacccaaagggagcacgagaagcactgacagacttcagaaggcttcagga
aagacaaaaagggcaggccggaagacaaagggctcaacatcgaagagaacaaaaccccga
gatcccagacacacccttgatggattttttaaatga

DBGET integrated database retrieval system