KEGG   Rattus norvegicus (rat): 171576
Entry
171576            CDS       T01003                                 

Gene name
Bub1b
Definition
(RefSeq) mitotic checkpoint serine/threonine-protein kinase BUB1 beta
  KO
K06637  mitotic checkpoint serine/threonine-protein kinase BUB1 beta [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    171576 (Bub1b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    171576 (Bub1b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    171576 (Bub1b)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    171576 (Bub1b)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     171576 (Bub1b)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  BUB family
   171576 (Bub1b)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     171576 (Bub1b)
Motif
Pfam: Mad3_BUB1_I Pkinase Mad3_BUB1_II
Other DBs
NCBI-GeneID: 171576
NCBI-ProteinID: NP_612549
RGD: 619791
Ensembl: ENSRNOG00000007906
Position
3
AA seq 1052 aa
MAAASEATCVEGDEWELSKENVQPLRHGRIMATLQGALAQQESACSTTLQQQKWAFESEI
RFYSGNDPLDVWDRYINWTEQNYPQGGKESNMSTLLERAIEALQGEKRYYSDPRFLNLWI
KLGHLCNEPLDMYSYLHSQGIGISLAQFYISWAEEYEARENFKKADIVFQQGIECKAEPL
DRLQSQHRQFQARVSRQALLALGNEEEEVLGSSEPQRSTLAELKSRGKKMARAPINRVGG
ALKAPGQSRGFLNTLPQPVHSNRRITVFDENADSASRPELSKPVAQPWMAPPVPRAKENE
LQPGPWNTDRPLEYRPHSNPASVTSVPSVLPNFTPYVEESAQQTVMTPCKIEPSINHVLS
TRKPGREEGDPLQRVQSHQQGCEEKKEKMMYCKEKIYAGVGEFSFEEIRAEVFRKKLKER
REAELLTSAKKREEMQKQIEEMERKLKAMQTIQQERAGDQQEERMLSKDSARLEIASESQ
EMSGVPPSCSIWPLSSNPREISPAENILQEQPETKGPSMPFSIFDESLSDKKDKSPATDG
PQVLNAQRRPLTVLKTTEVIPANEDISPDVCDELTEIEPLSEDAIITGFRNGILCPNPED
TCDFARAARFASTPFHEILPSKSIASDPKEGLQEEDLDGKATEGHHIVHLQTLSVKKLSP
IIEDSREATHSSGFSRSSSSVTSTSSIKGFQILEKLELTTDAAENAIQSPWCSHYRLQLL
KSLPELSAFAEFSVEDRPMPMLELGKEIELGHEDYCIKQEHLTCEDYRLFWVAPRNSAEL
TMIKASSQPLPWDFYINLKLKERLNEDCDQLCSCCQYQDGHVVWYQYINCSTLQDLLQHS
EFVTHEIIVLIICNLLTIVEKLHKAEIVHGDLSPRSLILRNRIHDPYDYINKDDHAVRIV
DFSYSVDMRVQLDAFAYSGFRTAQVLEGQKILANCSSPYQVDLLGIADLAHLLLFKEHLH
VFWDGLLWRLSQNTSELKDGELWNKFFVQILNASDKSTVFILRELAAEMSGAFDTTFHSH
LNKALWKLGKVISPEASLIQQDKQSSLLQNPA
NT seq 3159 nt   +upstreamnt  +downstreamnt
atggcggcggcgagtgaagccacgtgcgtggagggagatgagtgggaactgagtaaagaa
aacgtacaacccttacggcatggacggatcatggccacacttcagggagcgttggcacag
caggagtcagcctgcagcactaccctgcagcagcagaagtgggcgtttgaatctgaaatc
cgcttttactctggaaatgaccctctggatgtttgggacaggtatattaattggacagaa
cagaactaccctcagggcgggaaggagagtaacatgtcaacgttactagagagagcgata
gaagccctccaaggggagaagcgctattacagtgacccccggtttctcaatctctggatc
aaattggggcatttgtgcaatgagcctttggatatgtatagctatttacacagccaaggc
attggcatttccctggcccagttctatatctcgtgggctgaagagtacgaagctagagaa
aatttcaagaaagcagatatagtattccagcaagggattgaatgcaaggcggagcccctg
gacagactgcagtcccagcacagacagttccaggctcgagtgtctcgacaagctctcttg
gctcttgggaatgaagaggaggaggtcttggggtcctctgaaccacaaagaagcacgctc
gctgagctgaagagcagagggaagaagatggccagagcgcccatcaaccgtgttggaggt
gctctgaaggctccaggtcagagcagaggattcctaaatacacttcctcagccagtacac
agcaatcgcaggatcactgtttttgatgaaaatgctgatagtgcttctaggccggagctc
tctaagcctgtagcccagccatggatggcaccccctgtccctagggccaaagagaacgag
cttcagccaggcccgtggaacacagacaggcccttggaatataggcctcatagcaaccca
gcctctgtgacatctgtacccagtgtgcttcccaactttactccgtatgtggaagagagc
gcccagcagacagtaatgacgccatgtaaaatcgaacctagtatcaaccatgttctcagc
accagaaagccagggagagaggaaggagaccccttgcagagagttcagagtcatcagcaa
gggtgtgaggagaagaaggagaagatgatgtactgtaaggagaagatttatgccggagtt
ggggagttctcctttgaggagatccgagccgaagtgttccggaagaagctgaaagagcga
agggaagccgaactgctgaccagtgcaaagaagagggaagaaatgcagaagcagattgaa
gagatggagagaaagctaaaagcaatgcagactattcagcaagaaagagctggtgaccag
caagaagagaggatgctttcaaaggactcagccagattggagattgcttcagagtctcag
gaaatgtcgggagtgcctccgtcctgttccatctggccactaagctcgaatcctagggaa
atctcacctgctgagaacattttgcaagaacaacctgagaccaaaggtcccagtatgccg
ttttccatttttgatgagtctctttcggacaaaaaggacaaaagtcctgctacagatggt
ccacaagttctcaatgcccagcgaagaccccttacagttctcaaaactacagaagtcatc
cctgcaaatgaggacatatctcctgatgtttgtgatgaacttacagaaattgaacctttg
agtgaagatgccatcatcaccggtttcaggaatggaattctttgtcccaaccctgaggac
acttgtgactttgctagagcagctcgttttgcttctactccgttccatgagatactgccc
tcgaaaagcatcgcttctgatcccaaggaagggttgcaggaagaggatctggatgggaag
gccactgagggtcatcacattgttcatctccagactctcagcgtaaagaagctgagccca
attattgaagacagccgtgaggccacccactcatctggcttctccagatcctcttcttca
gttaccagtacatcctctatcaaaggctttcagattctggaaaagctggagctgactact
gatgcagcagaaaatgctattcaatcaccctggtgttcacattatcgcctacaactctta
aaatccctaccagaactaagtgcttttgcagagttttctgtggaagacaggccgatgcct
atgctggaactagggaaagaaattgagttaggtcacgaagattactgcatcaaacaagag
cacctaacatgtgaagattacaggttattctgggtggcaccaaggaactctgcagagctg
accatgataaaggcatcttctcagcctctcccgtgggatttttatatcaacctcaagtta
aaggagcgtctgaatgaggactgcgaccagctttgcagctgctgtcagtatcaagatggc
catgttgtgtggtaccagtatataaactgctccacccttcaggaccttctccaacacagc
gaatttgttactcatgaaataatagtgttgattatttgtaaccttttgacaatagtggag
aagctgcacaaagctgagatagtgcatggagacttgagtccaaggagtctgattctacgg
aacagaatccacgacccctatgactatataaataaggacgaccatgctgtgaggatagtg
gacttttcctacagtgttgacatgagggtgcagctggatgcatttgcctatagtggcttt
cggactgcacaggtcctggaaggacaaaagatcctggctaactgttcttctccctaccag
gtagatctgttgggtatagcagacctagcacacttactgttgttcaaggagcacctgcat
gtcttctgggatggactcctctggagacttagccaaaatacctctgagctaaaggacggt
gaattgtggaataaattctttgtgcagattctgaatgccagtgacaagtccacggtgttc
attctgagggaacttgcagcagaaatgagtggggcttttgacaccacattccacagccac
ctcaacaaagccttgtggaagttggggaaggtaattagtccggaagcttcgctcattcag
caagacaagcagtcaagtctcttacagaaccctgcctaa

DBGET integrated database retrieval system