KEGG   Rattus norvegicus (rat): 191568
Entry
191568            CDS       T01003                                 

Gene name
Naip6
Definition
(RefSeq) baculoviral IAP repeat-containing protein 1b isoform X1
  KO
K12807  baculoviral IAP repeat-containing protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04621  NOD-like receptor signaling pathway
rno05132  Salmonella infection
rno05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    191568 (Naip6)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    191568 (Naip6)
   05134 Legionellosis
    191568 (Naip6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    191568 (Naip6)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rno04054]
    191568 (Naip6)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I32: IAP family
   191568 (Naip6)
Pattern recognition receptors [BR:rno04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   191568 (Naip6)
SSDB
Motif
Pfam: BIR NLRC4_HD NACHT NOD2_WH AAA_30 DUF2486
Other DBs
NCBI-GeneID: 191568
NCBI-ProteinID: XP_006231924
RGD: 621281
Position
2
AA seq 1403 aa
MAAQGEAFEERICEFDDDLVSEFSTLLRVDALQVLKRQQEEDHKTRMKMKKGFNAQMRSE
AKRLKTFVTYDTFRSWTPQEMAAAGFYYTGVRHGVQCFCCSLILFATRLRKVPIEVHRKL
QPECEFLSGKDVGNIGKYDIRVKSPETLPRGGRARYHEEEARLESFEDWPFYAHGTSPRV
LSAAGFVFTGKRDTVQCFSCGGCLGNWEEGDDPWKEHAKWFPKCEFLQSKKSAEEIAKYI
QTYEGFLHVTGEHFVNSWVRRELPVVSAYSNDSVFANEGLRMDTFKDWPHESPMAVEALV
KAGLFYTGKKDIVQCFSCGGCMENWKEGDDPIEDHTKFFPNCVFLQTLKSSAEVIPALQS
HCARPEAMETTSESNHEDGVAVHSSVADLGQSEAQWCQEARSLSEQLRGTYTKASFRHMN
LPEAYSSLGTDHLLGCEVFLISKHVSRPVQVALTIPEVFANLSSVMCVEGEAGSGKTTFL
KRIAFLWASGCCPLLNRFQLVFYLSLRSIRADQGLADIICAQLLEAGGCISEVSLSSGIQ
HLQHQVLFLLDDYSGMDSLPQALDTLITKNYLSRTCLLMAVHTNRVRDIRPYLETVLQIK
EFPFYNTVYILKKIFSHDIIRVRRFINYFGFHEYLQGIHKTPLFVAGVCADWLQNPSDQP
FQDVTIFKSYMQYLFLKHKATAGPLQATVSSCGHLALTGLFSSSFEFSSDDLIEAGVDED
EELSTCLMSKFTAQRLRPVYRFLSPLFQEFLAAMRLSELLGSDSQEDQDLGLYYLRQINS
PLKAMSIYHTFLRYVSNHPSSKAGPKVISHLLQLVDEKESPENTSENEDYMKLHPETLLW
SQCLRGLLQLSPESFSLFISERLLNIALNFAYQSNTVAACSPVILQFLQGRTLDLKVLNL
QYFWDHPETLLLLKSIQVLFNGNNRVQRIDFSLMDKSFEKIQPPTIDQDYAFAFQPMSEC
QRNLAEKENIIKNYDDMKYQDPLNISSGYWKLSPKPYKIPRLEVGVNNMGPADQALLHVL
MEVFSASQSIEFHLFNSSGFLESIRPALELNKTSVTKCSMSRLELSRAEQELLLTLPALQ
SLEVSGTSQIPDQLFHNLDKFLGLKELSVRLDGTQDMLSVLPGEFPNLHHMEKLSIHTST
ESDLSKLVKLIQNSPNLHDFHLKCDFLSNCESLMAALASCKKLREIEFSGRCFEAVPFVN
ILSNFASLKILNLRNQQFPDKETSEKFAQALGSLRNLEELHLPTGDGIHQVAKPIVRRCL
QLPCLRVLVFAETLDDDSVLEIAKGATSGGFQNLENLDLTLNHKITEEGYRNFFQALDNL
PNLQNLDISRHIPECIQVQASTVKALGQCVSRLPSLTRLGMLSWLLDEEDMKVINDVKER
HPQSKRLTVHWRWVVPFSPVIQK
NT seq 4212 nt   +upstreamnt  +downstreamnt
atggcagcccagggagaagcctttgaggagagaatttgtgagtttgatgatgacttggtc
tctgagttctctactcttctccgagtggatgcacttcaagtcttaaagagacaacaagaa
gaagaccataaaacacgaatgaaaatgaagaaaggttttaatgcacagatgcgcagtgaa
gccaaacggctgaagacttttgtgacctatgacacattcagatcatggaccccacaggag
atggcagctgctgggttttactacacgggtgtgagacatggggttcagtgcttctgctgt
agcttaatcctttttgccaccagactcaggaaagttcccatagaagttcaccggaaatta
caaccagaatgtgagttcctctcgggcaaagatgttggaaacattggcaagtacgacata
cgggtgaagagtccagagacgctgccgagaggtggcagagcaaggtaccatgaggaggag
gccagactggagtcctttgaggactggccgttttatgcccatgggacatcacctcgtgta
ctctcagctgctggctttgtcttcacaggtaaaagggacactgtgcagtgtttctcctgt
ggcggatgcttgggaaactgggaagaaggagatgatccctggaaggagcatgccaagtgg
ttccccaaatgtgaatttcttcaaagcaagaagtccgcagaggaaattgccaagtacata
caaacctacgagggatttcttcatgtaacgggagaacattttgtgaattcctgggtcaga
agagaattacctgtagtatcagcttacagcaatgacagtgtctttgctaatgaaggacta
agaatggacacgtttaaggactggccccacgaatcacctatggctgttgaagctctggtc
aaagcaggtcttttctacacaggcaaaaaggacatcgtccagtgtttctcctgtggagga
tgcatggagaattggaaggaaggtgatgacccaatagaagatcacaccaagttttttccc
aactgtgtatttcttcaaaccctgaagtcctctgcagaagtgattccagcccttcagagc
cactgtgcacgtccagaagccatggaaaccacaagtgaaagcaaccatgaggatggagtg
gcagttcattcttctgtagcggacttgggtcagagtgaagcccagtggtgtcaagaggcc
aggagtctgagtgagcagctgagaggcacctacaccaaagccagtttccgacacatgaac
ctgcccgaggcgtattccagcctcggcactgaccacttgctcggctgcgaggtgttcctc
atttcaaagcacgtcagccggccagtgcaagtggccctgacaatccccgaggtcttcgcc
aatcttagctctgtcatgtgtgtggagggggaagctggcagtgggaagaccaccttcctg
aagaggatagctttcctctgggcatcaggatgctgtcccctgttgaacaggttccagctg
gtcttctacctctcccttcgttccatcagagcagaccagggactggccgacatcatctgt
gcccagctcctagaggcaggaggatgcatcagtgaagtgagcctgagcagcggcatccag
cacttacaacaccaggtcctgtttctgttggatgactacagtgggatggactccctcccc
caagccctagacacactgattaccaaaaactacttgtcacggacctgcttactgatggcc
gtccataccaacagggtcagggacatccgcccatatctagagacagttctacagatcaaa
gagtttcccttttataatactgtctatatattaaagaagatcttctcacatgacataatt
cgtgtgcgaagatttataaattactttggatttcatgaatatttacagggaattcacaaa
acccccctctttgtggcaggagtatgcgctgactggcttcaaaatccatctgaccagccc
tttcaggatgtgaccattttcaagtcctacatgcaatacctgttcttaaagcacaaagct
acagccgggcctctccaggccaccgtgtcctcctgtgggcatctggccttgacagggctt
ttctcatcgagctttgagttcagtagtgatgacctcatagaggcaggagttgatgaagac
gaagagctcagcacctgcttgatgagcaaattcaccgcccagaggctgagaccagtctac
cggtttttaagtcctctgttccaagagtttcttgctgccatgaggctctcagaactcctg
gggtcagatagtcaagaagaccaagatctgggactgtattatttgagacaaattaactca
cctctgaaggccatgagcatctaccacacttttttgaggtatgtctccaaccacccttca
tcaaaggcagggccaaaagttatatctcatttgcttcagttggtggatgagaaagagtcc
ccggagaacacgtctgaaaatgaggattacatgaagctccatccagaaactttgctgtgg
agtcagtgtcttagagggctgttgcagctgtctcctgaatctttctctttgttcatttca
gaacgtttactgaacattgccctaaactttgcttatcaaagcaacacagttgctgcatgc
tctccagttattttgcagttccttcaagggaggacactggatttgaaagtactgaattta
cagtacttttgggaccacccagaaaccctgttactattgaagagtattcaggtcttattt
aatgggaataacagggtacagagaattgatttttctctcatggacaaatcttttgaaaaa
atacagccaccaactatagatcaggactatgcctttgcctttcaacctatgagtgaatgc
cagagaaatttagctgaaaaggaaaacataataaagaactatgatgatatgaaatatcag
gatccactaaatattagtagtggctattggaaactgtcccccaagccttacaagatccct
aggctggaagttggagtgaacaacatgggtccggcagaccaggctctgctccatgtccta
atggaagtcttctcagcctcacagagtattgagttccatttattcaacagcagtggcttt
cttgaaagcatccgcccagctctggagctgaataagacctctgtcaccaagtgttccatg
tccaggctggagctcagcagagcagaacaggagctgcttctcaccctgcctgccctgcag
tctcttgaggtctcaggaacaagccagattccagatcagctcttccataacttggacaag
ttcctgggcctgaaagaactgtctgtgagactagatggcacacaggacatgctctcagtc
cttccgggagagttcccaaacctccatcacatggagaagttatccatccacacctccacg
gagtctgacctctccaaactagttaaattgattcagaactctccaaatctgcatgatttc
cacctgaaatgtgatttcctttcgaattgtgagtctctcatggctgcgcttgcttcctgc
aagaaactcagagagattgagttttctgggcgatgctttgaagccgtgccctttgtcaac
attttgtcaaattttgcttctttgaagatattgaatcttagaaaccaacaattcccagat
aaggaaacatcagaaaagtttgcccaggctctgggttctctcaggaacctggaggaactg
caccttcccactggggatgggatccaccaagtggccaaaccgattgtccggcggtgtctg
cagcttccctgtctccgagttctcgtctttgcagagacattggatgatgacagtgtgctg
gaaattgccaagggagcaaccagtggaggcttccaaaatctggagaacttagacctcaca
ctgaatcacaagattactgaggaaggctacaggaatttctttcaagccctggacaacctg
ccaaacctgcaaaatctggacatctccaggcatatcccagaatgcatccaagttcaggcc
agcaccgtcaaggctctgggtcagtgtgtgtcccgactgcccagcctcaccaggctgggg
atgctcagttggctgctggatgaagaggacatgaaagtgattaatgacgtgaaggaaaga
caccctcagtccaaacgcctgactgtgcactggaggtgggtggtgccgttctctcctgtc
attcagaagtga

KEGG   Rattus norvegicus (rat): 294691
Entry
294691            CDS       T01003                                 

Gene name
Naip5
Definition
(RefSeq) baculoviral IAP repeat-containing protein 1e isoform X1
  KO
K12807  baculoviral IAP repeat-containing protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04621  NOD-like receptor signaling pathway
rno05132  Salmonella infection
rno05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    294691 (Naip5)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    294691 (Naip5)
   05134 Legionellosis
    294691 (Naip5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    294691 (Naip5)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rno04054]
    294691 (Naip5)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I32: IAP family
   294691 (Naip5)
Pattern recognition receptors [BR:rno04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   294691 (Naip5)
SSDB
Motif
Pfam: BIR NLRC4_HD NACHT NOD2_WH LRR_4 AAA_30
Other DBs
NCBI-GeneID: 294691
NCBI-ProteinID: XP_226743
RGD: 1559914
Position
2
AA seq 1402 aa
MAEHGEASEDQVSEFDGECLPELSALLGVDAVQLVKSQEEEENKERMKMKKGFNAQMRSE
AKRLKTFVTYDAFKSWTPQEMAAAGFYYTGVRHGVQCFCCSLILFGTSLRKVPIESHRKL
RPQCEFLSGKDVGNIGKYDIRVKNPETLPRGGRARYHEEEARLESFEDWPFYAHGTSPRV
LSAAGFVFTGKRDTVQCFSCGGCLGNWEEGDDPWKEHAKWFPKCEFLQSKKSTEEINQYI
QSYTGFLHVAGEHFVNSWVRRELPVVSAYSNDSVFANEGLRMDTFKDWPHESSVAVEALV
KAGLFYTGKKDIVQCFSCGGCMENWKEGDDPIEDHTKFFPNCVFLQTLKSSAEVIPALQS
HCACPEAMETTSESNHEDPVAVHSSVAGLGQSEAQWCQEARSLSEQLRGTYTKASFRHMN
LPEAYSSLGTDHLLGCEVFLISKHVSRPVQVALTIPEVFANLSSVMCVEGEAGSGKTTFL
KRIAFLWASGCCPLLNRFQLVFYLSLRSIRADQGLADIICAQLLEAGGCISEVSLSSGIQ
HLQHQVLFLLDDYSGMDSLPQALDTLITKNYLSRTCLLMAVHTNRVRDIRPYLETVLQIK
EFPFYNTISVLRKFFSHNTTRLLEFMVYFGRNEDLQGVHKTPLFVAAVCTDWFQNPSDQP
FQDVTIFKSYMQYLFLKHKATAGPLQATVSSCGHLALTGLFSSSFEFSSDDLIEAGVDED
EELSTCLMSKFTAQRLRPVYRFLSPLFQEFLAAMRLSELLGSDSQEDQDLGLYYLRQINS
PLKAINSYGIFLKYVSDHCSSKAGPKVVSHLLQLVDEKESLENMSENEDYMKLHPETFLW
LHFLRGLWLNSPESFSSLLSERLLNIALNFAYQSSTVAACSPVILQFLRGRTLALGVLNS
QYFWDHPESLLLLGSLKVSINGNEISSHVDYSFKTYFENLQPPAIDKEYTSAFEHISEWK
RNFAEDEKIIKHYQNIWPRVLPDISEGYWKLSPKPYKIPRLEVGVNNMGPADQALLHVLM
EVFSASQSIEFQLFNSSGFLESIRPALELNKTSVTKCSMSRLELSRAEQELLLTLPALQS
LEVSETNQIPDQLFHNLDKFLGLKELSVRLDGTQDVLSVLPGEFPNLHHMEKLSIHTFTE
SDLSKLVKLIQNSPNLHDIHLKCDFLSNCESLMAALASCEKLREIEFSGRCFEAMPFVTL
LPNFVFLKILNLKGQQFPDKETSEMFAQALGSLRKLEELHLPKGDGIHQVAKLIVQQCLQ
LPCLRVLAFHHVLDDDSVTEVARVATSRGFQKLENLDLSMNHKITEEGYRNFFQALDNLP
NLQELNICRHIRECIQVQASTVKALGQCVSRLPSLTRLRMLSWLLDEEDMKVINDVKERH
PQSKRLTVFWKWIVPFSPVVQE
NT seq 4209 nt   +upstreamnt  +downstreamnt
atggctgagcatggggaggcctctgaggatcaagtttctgagtttgatggtgaatgtctc
cctgagctctctgctcttctcggggtggatgcagttcagctggtaaagagccaagaagaa
gaagagaataaagaacggatgaaaatgaagaaaggttttaatgcacagatgcgcagtgaa
gccaaacggctgaagacttttgtgacctatgatgcgttcaaatcgtggaccccacaggag
atggcagctgctgggttttactacacgggtgtgagacatggggttcagtgcttctgctgt
agcttaatcctctttggtactagcctcaggaaagttcccatagagagccacaggaaatta
cgaccccaatgtgagttcctctcgggcaaagatgttggaaacattggcaagtacgacata
cgggtgaagaatccagagacgctgccgagaggtggcagagcaaggtaccatgaggaggag
gccagactggagtcctttgaggactggccgttttatgcccatgggacatcacctcgtgta
ctctcagctgctggctttgtcttcacaggtaaaagggacactgtgcagtgtttctcctgt
ggtggatgcttgggaaactgggaagaaggagatgatccctggaaggagcatgccaagtgg
ttccccaaatgtgaatttcttcaaagtaagaaatccacagaggaaattaaccagtatatt
caaagctacacgggatttcttcatgtagcgggagaacattttgtgaattcctgggtgaga
agagaattacctgtggtatcagcttacagcaatgacagtgtctttgctaatgaaggacta
agaatggacacgtttaaggactggccccatgaatcatctgtggctgttgaagctctggtc
aaagcaggtcttttctacacaggcaaaaaggacatcgtccagtgtttctcctgtggagga
tgcatggagaattggaaggaaggtgatgacccaatagaagatcacaccaagttttttccc
aactgtgtatttcttcaaaccctgaagtcctctgcagaagtgattccagcccttcagagc
cactgtgcatgtccagaagccatggaaaccacaagtgaaagcaaccatgaggatccagta
gcagtgcattcttctgtggcaggcttgggtcagagtgaagcccagtggtgtcaagaggcc
aggagtctgagtgagcagctgagaggcacctacaccaaagccagtttccgccacatgaac
ctgcccgaggcgtattccagcctcggcactgaccacttgctcggctgcgaggtgttcctc
atttcaaagcacgtcagccggccagtgcaagtggccctgacaatccccgaggtcttcgcc
aatcttagctctgtcatgtgtgtggagggggaagctggcagtgggaagaccaccttcctg
aagaggatagctttcctctgggcatcaggatgctgtcccctgttgaacaggttccagctg
gtcttctacctctcccttcgttccatcagagcagaccagggactggccgacatcatctgt
gcccagctcctagaggcaggaggatgcatcagtgaagtgagcctgagcagcggcatccag
cacttacaacaccaggtcctgttcctgttggatgactacagtgggatggactccctcccc
caagccctagacacactgattaccaaaaactacttgtcacggacctgcttactgatggcc
gtccataccaacagggtcagggacatccgcccatatctagagacagttctacagatcaaa
gagtttcccttctataatactatctctgtattacgtaagtttttctcccataatacaaca
cgtctgttagagtttatggtttattttggaaggaatgaggacttacagggagttcacaaa
acccccctctttgtggcagcagtatgcactgactggtttcaaaatccatctgaccagccc
tttcaggatgtgaccattttcaagtcctacatgcaatacctgttcttaaagcacaaagct
acagccgggcctctccaggccaccgtgtcctcctgtgggcatctggccttgacagggctt
ttctcatcgagctttgagttcagtagtgatgacctcatagaggcaggagttgatgaagac
gaagagctcagcacctgcttgatgagcaaattcaccgcccagaggctgagaccagtctac
cggtttttaagtcctctgttccaagagtttctggctgccatgaggctctcagaactcctg
gggtcagatagtcaagaagaccaagatctgggactgtattatttgagacaaattaactca
cctctgaaggctataaactcctatggcatatttttgaagtatgtctccgaccactgttcc
tcaaaggcagggccaaaagttgtatctcatttgcttcagttggtggatgagaaagagtcc
ctggagaacatgtctgaaaatgaggattacatgaagctccacccagaaacttttctgtgg
ttgcattttcttagagggttgtggctaaattctcctgaatctttctcttcactcctttca
gaacgtttactgaacattgccctaaactttgcttatcaaagcagcacagttgctgcatgc
tctccagttattttgcagttccttcgagggaggacactggctttgggagtactgaattca
cagtacttttgggaccacccagaaagcctgttactgttggggagtttaaaggtttctata
aatggaaatgaaatctcatctcatgtggattattcattcaagacatattttgaaaactta
cagccaccagctatagataaggagtacacatctgccttcgagcacataagtgaatggaag
agaaattttgctgaagatgagaagatcataaagcactatcaaaatatctggcccagggtc
ctaccagacatcagtgaagggtactggaaactgtcccccaagccttacaagatccctagg
ctggaagttggagtgaacaacatgggtccggcagaccaggctctgctccatgtcctaatg
gaagtcttctcagcctcacagagcattgagttccagttattcaacagcagtggctttctt
gaaagcatccgcccagctctggagctgaataagacctctgtcaccaagtgctccatgtcc
aggctggagctcagcagagcagaacaggagctgcttctcaccctgcctgccctgcagtct
cttgaggtctcagagacaaaccagattccagatcagctcttccataacttggacaagttc
ctgggcctgaaagaactgtctgtgagactagatggcacacaggacgtgctctcagtcctt
ccgggagagttcccaaacctccatcacatggagaagttatccatccacaccttcacagag
tctgacctctccaaactagttaaattgattcagaactctccaaatctgcatgatatccac
ctgaaatgtgatttcctttcaaactgtgagtctctcatggctgcgcttgcttcctgtgag
aaactcagagagattgagttttctggacgatgctttgaagccatgccatttgtcaccttg
ttgccaaattttgtttttctgaagatattgaatcttaaaggccaacaattcccagataag
gaaacatcagaaatgtttgcccaggctctgggttctctcaggaagctggaggaactgcac
cttcccaagggggacgggatccaccaagtggccaaactgattgtccagcagtgtctgcag
cttccctgtctccgagttctcgcctttcaccacgtcttggacgatgacagtgtgactgaa
gttgccagggtggcaactagcagaggtttccagaaactcgagaacttagatctttcaatg
aatcacaagattactgaggaaggatacagaaatttctttcaagccctggacaacctgcca
aacttgcaagagctgaacatctgcaggcatatccgagaatgcatccaagttcaggccagc
accgtcaaggctctgggtcagtgtgtgtcccgactgcccagcctcaccaggctgaggatg
ctcagttggctgctggatgaagaggacatgaaagtgattaatgacgtgaaggaaagacac
cctcagtccaaacgcctgactgtcttctggaaatggatagtcccgttctctcctgttgtc
caggagtaa

DBGET integrated database retrieval system