KEGG   Rattus norvegicus (rat): 192262
Entry
192262            CDS       T01003                                 

Symbol
C1s
Name
(RefSeq) complement C1s subcomponent precursor
  KO
K01331  complement component 1, s subcomponent [EC:3.4.21.42]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno05133  Pertussis
rno05150  Staphylococcus aureus infection
rno05171  Coronavirus disease - COVID-19
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    192262 (C1s)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    192262 (C1s)
  09171 Infectious disease: bacterial
   05133 Pertussis
    192262 (C1s)
   05150 Staphylococcus aureus infection
    192262 (C1s)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    192262 (C1s)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    192262 (C1s)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    192262 (C1s)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.42  complement subcomponent C_overbar_1s_
     192262 (C1s)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S1: chymotrypsin family
   192262 (C1s)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Opsonins
    192262 (C1s)
SSDB
Motif
Pfam: Trypsin CUB Sushi FXa_inhibition EGF_CA CUB_2 HRM Trypsin_2 hEGF EGF
Other DBs
NCBI-GeneID: 192262
NCBI-ProteinID: NP_620255
RGD: 619983
Ensembl: ENSRNOG00000011971
UniProt: Q6P6T1
Position
4
AA seq 694 aa
MGKSPEMWCFVFFSLLASFSAEPTMYGEILSPNYPQAYPNEVVKTWDIEVPEGFGIHLYF
THLDMELSENCAYDSVQIISGGIEEERLCGQRTSKSPNSPIVEEFQFPYNRLQVVFTSDF
SNEERFTGFAAYYSAVDVNECTDFTDVPCSHFCNNFIGGYFCSCPPEYFLHDDMRTCGVN
CSGDVFTALIGEIASPNYPNPYPENSRCEYQIRLQEGFRLVLTIRREDFDVEPADSEGNC
HDSLTFAAKNQQFGPYCGNGFPGPLTIKTQSNTLDIVFQTDLTGQNKGWKLRYHGDPIPC
PKEISANSIWEPEKAKYVFKDVVKITCVDGFEVVEGNVGSTSFYSTCQSNGQWSNSRLEC
QPVDCGVPEPIENGKVEDPEDTVFGSVIHYTCEEPYYYMEQEEGGEYHCAANGSWVNDQL
GVELPKCIPVCGVPTEPFKVQQRIFGGYSTKIQSFPWQVYFESPRGGGALIDEYWVLTAA
HVVEGNSDPVMYVGSTLLKIERLRNAQRLITERVIIHPSWKQEDDLNTRTNFDNDIALVQ
LKDPVKMGPTVAPICLPETSSDYNPSEGDLGLISGWGRTENRTNVIQLRGAKLPITSLEK
CQQVKVENPKARSNDYVFTDNMICAGEKGVDSCEGDSGGAFALPVPNVKDPKFYVAGLVS
WGKKCGTYGIYTKVKNYVDWILKTMQENSGPKKD
NT seq 2085 nt   +upstreamnt  +downstreamnt
atgggcaaatcgccagagatgtggtgctttgtcttcttttctcttttggcatcgttttct
gctgagcctaccatgtatggggagatcctgtcccctaattatccccaggcgtaccccaat
gaggtcgtgaaaacttgggacatagaagtcccagaggggtttgggattcacctttacttc
acccatctggacatggagctgtcagagaactgtgcatacgactcagtgcagataatctca
ggaggcatcgaggaagagagactctgtggccagaggaccagcaagagtcccaactccccc
attgtagaagagtttcaattcccatacaataggctccaggtggtctttacgtcagacttc
tccaacgaggaacggtttactggctttgcagcgtattactcagccgtagatgtaaatgaa
tgcacagactttacagatgtcccttgcagccacttctgcaataacttcattggtggatac
ttctgctcctgccccccagaatacttcctccacgatgacatgaggacttgtggggtcaac
tgtagtggggatgtattcactgccctgattggggagatcgcaagtcccaattatcccaac
ccatacccggagaactcaaggtgtgaataccagattcggctgcaggagggcttccgactg
gtgttgactatccggagagaagattttgatgtggaaccagctgactcagaggggaactgc
cacgacagtttgacttttgctgcaaaaaaccaacagtttggtccttactgtggcaatgga
ttccctggaccgctaactattaaaacccagagcaatactcttgatattgtctttcaaact
gacctaacggggcaaaataaaggctggaagcttcgttaccatggggatcccatcccctgt
cccaaagaaatcagtgctaattctatctgggagcccgaaaaggcaaaatacgtgttcaaa
gatgtcgtgaagataacctgtgtggatggattcgaagttgtggagggaaatgttggctca
acatcattctattccacttgtcaaagcaacggacagtggagcaattccaggctagagtgt
caacctgtggactgtggtgttccagaacccattgagaatggtaaagttgaagacccagaa
gacactgtattcggctccgtcatccactacacgtgcgaagagccatattactacatggaa
caggaagaaggcggagagtatcactgcgctgctaatgggagctgggtgaatgaccagctg
ggtgtcgagcttccaaaatgtattccagtctgtggagtacccaccgagccctttaaagta
cagcagaggatatttggaggatactctacaaagattcaaagttttccttggcaggtctac
tttgagtccccccgaggtggcggggctcttatcgatgagtactgggtgctgacggccgct
cacgttgtggagggaaactctgacccagtgatgtatgtcgggtccacacttctgaaaata
gagcggttgagaaatgcccagaggctcatcactgaacgtgtgattattcatcccagctgg
aaacaagaggacgacctgaatacacggacaaattttgacaatgacattgccctggtgcag
ctcaaagaccctgtgaaaatgggacccactgttgcccccatctgcctgccagaaacctcc
tcagactacaacccctcagagggtgacctggggctgatctctgggtggggccgaacagag
aatagaaccaatgttattcaactcagaggggcgaagttacccataacatctttagaaaag
tgccagcaggtgaaagtggaaaacccgaaagcgaggtcaaacgactatgttttcactgac
aacatgatctgtgctggggaaaagggtgtggacagctgtgagggtgacagcggaggggct
tttgctctgccggtccccaatgtcaaggaccccaaattctatgtggctggcctggtgtcc
tgggggaaaaagtgtgggacctatgggatctacacaaaggtaaagaactacgtggactgg
atcctgaaaactatgcaggagaatagtgggcccaagaaggactga

DBGET integrated database retrieval system