KEGG   Rattus norvegicus (rat): 192363
Entry
192363            CDS       T01003                                 

Gene name
Nos1ap
Definition
(RefSeq) carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein
  KO
K16513  carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04713  Circadian entrainment
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04713 Circadian entrainment
    192363 (Nos1ap)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    192363 (Nos1ap)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    192363 (Nos1ap)
SSDB
Motif
Pfam: PID
Other DBs
NCBI-GeneID: 192363
NCBI-ProteinID: NP_620277
RGD: 620106
UniProt: O54960
Position
13
AA seq 503 aa
MPSKTKYNLVDDGHDLRIPLHNEDAFQHGISFEAKYVGSLDVPRPNSRVEIVAAMRRIRY
EFKAKNIKKKKVSIMVSVDGVKVILKKKKKKKEWTWDESKMLVMQDPIYRIFYVSHDSQD
LKIFSYIARDGASNIFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQED
GESERNSDGSGDPGRQLTGAERVSTATAEETDIDAVEVPLPGNDILEFSRGVTDLDAIGK
DGGSHIDATVSPHPQEPMLAASPRMLLPSSSSSKPPGLGTGTPLSTHHQMQLLQQLLQQQ
QQQTQVAVAQVHLLKDQLAAEAAARLEAQARVHQLLLQNKDMLQHISLLVKQVQELELKL
SGQSTMGSQDSLLEITFRSGALPVLCESTTPKPEDLHSPLLGAGLADFAHPVGSPLGRRD
CLVKLECFRFLPAEDNQPMAQGEPLLGGLELIKFRESGIASEYESNTDESEERDSWSQEE
LPRLLNVLQRQELGDSLDDEIAV
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgcccagcaaaaccaagtacaaccttgtggacgatgggcacgacttacggatccctttg
cacaacgaggacgccttccagcacggcatctcttttgaggccaagtacgtgggaagcctg
gatgtgcccagacccaacagcagggttgagatcgtggctgccatgcgcagaatccggtat
gagtttaaagccaagaatatcaagaagaagaaagtaagcatcatggtctccgtggacggt
gtcaaagtgattctgaagaagaagaaaaagaaaaaggagtggacgtgggatgagagcaag
atgctggtgatgcaggaccctatctacaggatcttctatgtctctcatgactcccaagac
ttgaaaatcttcagctatatcgctcgagatggtgccagcaatatcttcagatgcaatgtc
tttaaatccaagaagaagagccaagctatgagaatcgtacggacagtgggacaggccttt
gaggtctgccacaagttgagcctgcagcacacacagcagaatgcagatggccaggaagat
ggagagagcgagaggaacagcgatggctcaggagacccaggccgccagctcactggagct
gagagggtctccacagccaccgcagaggagaccgacattgacgctgtggaggtcccactc
cccgggaatgacattctagaattcagccgaggtgtgactgacctggatgctattgggaag
gacggaggctcccacatagacgcgacggtctcaccccatccacaggagcccatgctggca
gcctcccctcgcatgctgctcccttcttcttcttcctcgaagccaccgggcttgggcact
gggacgcccctgtccactcaccaccagatgcagctcctccagcagctcctccagcagcag
cagcagcagacacaagtggctgtggctcaggttcacttgctgaaggatcagttggctgct
gaggctgcggcacggctggaggcccaggcacgagtgcaccagctcctgctacagaacaaa
gacatgcttcagcacatctctctgctggttaagcaggtgcaggagctggaactgaagctg
tcaggacagagcaccatgggctcccaggacagcttgctggagatcaccttccgttcaggt
gccctgcctgtgctctgtgaatccaccactcctaagccagaggacctacactcaccactg
ctgggcgctggcttggctgactttgcccacccagtgggcagccccttaggtaggcgtgac
tgcttggtgaagctggagtgctttcgtttcctcccagccgaggataaccagccgatggca
cagggtgagccgctcctaggtggcctggagctcatcaagttccgagagtcaggcatcgcc
tcagagtatgagtccaacacagacgaaagcgaggagcgtgactcgtggtcgcaggaagag
ctgccacgcctgctcaatgtcctacagcggcaggagttgggtgacagtttggatgatgag
atcgccgtgtag

DBGET integrated database retrieval system