KEGG   Rattus norvegicus (rat): 24224
Entry
24224             CDS       T01003                                 

Gene name
Bcl2
Definition
(RefSeq) apoptosis regulator Bcl-2
  KO
K02161  apoptosis regulator Bcl-2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno01524  Platinum drug resistance
rno04064  NF-kappa B signaling pathway
rno04066  HIF-1 signaling pathway
rno04071  Sphingolipid signaling pathway
rno04115  p53 signaling pathway
rno04140  Autophagy - animal
rno04141  Protein processing in endoplasmic reticulum
rno04151  PI3K-Akt signaling pathway
rno04210  Apoptosis
rno04215  Apoptosis - multiple species
rno04217  Necroptosis
rno04261  Adrenergic signaling in cardiomyocytes
rno04340  Hedgehog signaling pathway
rno04510  Focal adhesion
rno04621  NOD-like receptor signaling pathway
rno04630  JAK-STAT signaling pathway
rno04722  Neurotrophin signaling pathway
rno04725  Cholinergic synapse
rno04915  Estrogen signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05014  Amyotrophic lateral sclerosis
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05162  Measles
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
rno05206  MicroRNAs in cancer
rno05207  Chemical carcinogenesis - receptor activation
rno05210  Colorectal cancer
rno05215  Prostate cancer
rno05222  Small cell lung cancer
rno05226  Gastric cancer
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    24224 (Bcl2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    24224 (Bcl2)
   04630 JAK-STAT signaling pathway
    24224 (Bcl2)
   04064 NF-kappa B signaling pathway
    24224 (Bcl2)
   04066 HIF-1 signaling pathway
    24224 (Bcl2)
   04071 Sphingolipid signaling pathway
    24224 (Bcl2)
   04151 PI3K-Akt signaling pathway
    24224 (Bcl2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    24224 (Bcl2)
  09143 Cell growth and death
   04210 Apoptosis
    24224 (Bcl2)
   04215 Apoptosis - multiple species
    24224 (Bcl2)
   04217 Necroptosis
    24224 (Bcl2)
   04115 p53 signaling pathway
    24224 (Bcl2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    24224 (Bcl2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    24224 (Bcl2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    24224 (Bcl2)
   04928 Parathyroid hormone synthesis, secretion and action
    24224 (Bcl2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    24224 (Bcl2)
  09156 Nervous system
   04725 Cholinergic synapse
    24224 (Bcl2)
   04722 Neurotrophin signaling pathway
    24224 (Bcl2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24224 (Bcl2)
   05206 MicroRNAs in cancer
    24224 (Bcl2)
   05207 Chemical carcinogenesis - receptor activation
    24224 (Bcl2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    24224 (Bcl2)
   05226 Gastric cancer
    24224 (Bcl2)
   05215 Prostate cancer
    24224 (Bcl2)
   05222 Small cell lung cancer
    24224 (Bcl2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    24224 (Bcl2)
   05161 Hepatitis B
    24224 (Bcl2)
   05162 Measles
    24224 (Bcl2)
   05168 Herpes simplex virus 1 infection
    24224 (Bcl2)
   05169 Epstein-Barr virus infection
    24224 (Bcl2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    24224 (Bcl2)
   05152 Tuberculosis
    24224 (Bcl2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    24224 (Bcl2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    24224 (Bcl2)
   05022 Pathways of neurodegeneration - multiple diseases
    24224 (Bcl2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    24224 (Bcl2)
   05418 Fluid shear stress and atherosclerosis
    24224 (Bcl2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    24224 (Bcl2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    24224 (Bcl2)
   01524 Platinum drug resistance
    24224 (Bcl2)
   01522 Endocrine resistance
    24224 (Bcl2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    24224 (Bcl2)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     24224 (Bcl2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 24224
NCBI-ProteinID: NP_058689
RGD: 2199
Ensembl: ENSRNOG00000002791
Vega: OTTRNOG00000002239
UniProt: P49950
Position
13
AA seq 236 aa
MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDTGDEDSAPLRAAPTPGIFSFQPESNRTPA
VHRDTAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTP
FTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNR
HLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
NT seq 711 nt   +upstreamnt  +downstreamnt
atggcgcaagccgggagaacagggtatgataaccgggagatcgtgatgaagtacatccat
tataagctgtcacagaggggctacgagtgggatactggagatgaagactccgcgcccctg
agggctgcccccacccctggcatcttctccttccagcctgagagcaaccggacgcccgct
gtgcaccgagacacggctgccaggacgtcgcctctacggccccttgtcgccaccgctggg
cctgcgctcagccctgtgccacctgtggtccacctgaccctccgccgggctggggatgac
ttctctcgtcgctaccgtcgcgactttgcagagatgtccagtcagctgcacctgacgccc
ttcaccgcgaggggacgctttgccacggtggtggaggaactcttcagggatggggtgaac
tgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggagagcgtcaac
agggagatgtcacccctggtggacaacatcgctctgtggatgactgagtacctgaaccgg
catctgcacacctggatccaggataacggaggctgggatgcctttgtggaactatatggc
cccagcatgcgacctctgtttgatttctcctggctgtctctgaagacgctgctcagcctg
gccctggtgggggcctgcatcactctgggtgcatacctgggccacaagtga

DBGET integrated database retrieval system