KEGG   Rattus norvegicus (rat): 24231
Entry
24231             CDS       T01003                                 

Symbol
C2
Name
(RefSeq) complement C2 precursor
  KO
K01332  complement component 2 [EC:3.4.21.43]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno04936  Alcoholic liver disease
rno05133  Pertussis
rno05150  Staphylococcus aureus infection
rno05171  Coronavirus disease - COVID-19
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    24231 (C2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    24231 (C2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    24231 (C2)
   05150 Staphylococcus aureus infection
    24231 (C2)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    24231 (C2)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    24231 (C2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    24231 (C2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.43  classical-complement-pathway C3/C5 convertase
     24231 (C2)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S1: chymotrypsin family
   24231 (C2)
SSDB
Motif
Pfam: Trypsin VWA Sushi VWA_2 DUF1986 HRM Trypsin_2 Longin_2 DUF5083
Other DBs
NCBI-GeneID: 24231
NCBI-ProteinID: NP_757376
RGD: 2231
Ensembl: ENSRNOG00000051235
Vega: OTTRNOG00000001010
UniProt: Q6MG73
Position
20
AA seq 758 aa
MAPLLALLALLQLGPGLAALSCPQNVNIVGGNFTLSRGWAPGSVLIYSCPLGRYPSPAWR
ECQSNGQWQTPRASSLPTLRSSRLAKAVCKPVRCPAPTSFENGIYIPRLGSYPVGGNLSF
ECEHGFTLRGSPVRYCRPNGVWDGETAVCDNGASHCPNPGISVGTMRTGSSFDLGDKVSY
RCSSTNLVLTGSVERECLSNGVWSGSEPICRQPYSYDFPEDVASALGTSFTHLLGATNPI
QKRTENLGRKIQIQRSGHLNLYLLLDASQSVSEKDFNIFKESAFLMVDRIFSFEIKVSVA
IITFASRPKIIMSVLNERSQNVMEVMDSLDSVCYKDHENATGTNTYEALNSVYLMMNNQM
DRLGMETSAWQEIRHAIILLTDGKSNMGGSPKPAVDNIREILGISRNRNDYLDIYAIGVG
KLDVDWKELNELGSKKDGERHAFILQDAKAVQQVFEHILDVSKLTDTICGVGNMSVNASD
QERTPWQVTFKPKSKETCQGSLISDQWVLTAAHCFHDAQMEDRHLWRVIVGDPTSHHGKE
FHVEEVLVAPGFNVHAKQSQGISEFYADDIALLKLSQRVKMSSHARPICLPCTVGANMAL
RRSPGSTCKDHETELLSQQKVPAHFVALNGNRMNINLRTGPERTSCIEAVSQNKGSFPGL
TNVSEVVTDQFLCSGMEGDDSPCKGESGGAVFLERRYRFFQVGLVSWGLFDPCHGSSNKN
LRRKPPHGVVPRDFHISLFRLQPWLRQHLDGVLDFLPL
NT seq 2277 nt   +upstreamnt  +downstreamnt
atggcccctctgctggctctcctcgccctgctgcagctgggcccaggcctggctgctctt
tcctgccctcagaatgtcaatattgtcggggggaatttcactctcagccgtggctgggct
cctgggagcgtcctcatctactcctgccccctgggcaggtacccgtccccagcctggcgg
gaatgccagagcaacgggcagtggcagacaccaagagctagctcacttcccaccctgaga
tcctctcggttggctaaagccgtctgcaaacctgttcgatgtccagctcccacgtccttt
gagaatggcatctatatccctcggctggggtcctaccccgtgggtggcaacctgagcttc
gagtgtgagcatggtttcaccttgcggggctcgcccgtgaggtactgtcgccccaacggc
gtgtgggatggagagacggctgtgtgtgacaatggcgctagccactgccccaacccaggc
atctcagtgggcacaatgcggacaggctcgagctttgaccttggagacaaggtcagttac
cgctgttcctccacgaatctggtattgaccggctctgtagagcgggagtgtctgagtaac
ggagtgtggagtgggtcggagcccatctgccgacagccatactcttacgacttccctgag
gatgtagcatctgccctaggcacctccttcacccacctgcttggagccaccaatcccatc
cagaagaggacagaaaacctgggccgtaaaatccaaatccagcgctcgggccacctgaac
ctctatctgctgcttgatgcctctcagagcgtatcggaaaaagactttaacatcttcaag
gagagcgccttcctcatggtggacaggatcttcagcttcgagataaaggtcagcgtagct
atcatcaccttcgcctcacggcccaaaatcatcatgtccgtcctgaatgagagatcccag
aatgtgatggaggtgatggacagtctagactctgtctgctacaaagatcacgaaaatgcc
actggcactaacacttacgaggctctcaacagcgtctacctcatgatgaataaccagatg
gatcgcctcggcatggagacctctgcctggcaggaaatccgccatgccatcatcctgttg
actgacggaaagtccaacatgggtggctctcccaagccggcagtcgacaacatcagagag
atcctgggcatcagtcggaacagaaacgactacctggacatctatgcgattggggtgggt
aagctggatgtggactggaaggaactgaacgagctggggtccaagaaggacggcgagagg
cacgccttcatcttgcaggacgcaaaagctgtgcagcaggtctttgagcacattctggat
gtctctaagctcacagacaccatctgtggggtggggaacatgtccgtcaatgcctctgac
caggagaggacaccttggcaagtcacctttaagcccaagagtaaggagacttgccagggg
tcgcttatctctgaccagtgggtgctgactgcggctcactgcttccatgacgctcagatg
gaggaccgccacctgtggagggtcatcgtgggggatcccacctctcatcacggcaaagaa
ttccatgtggaggaggtgttagttgcccctgggtttaatgtccacgcaaagcagagccag
ggcatctcggagttctacgctgatgacattgccctgctgaagctgtctcagagagtgaaa
atgtccagccacgccaggcccatctgccttccttgcacagtgggggccaacatggctctg
cggagatccccaggtagtacctgtaaagaccatgagacagaacttctgtcacagcagaag
gttcctgcgcatttcgtagctctgaacgggaacagaatgaacatcaacctcaggacagga
cctgagaggacaagctgtatcgaggctgtctcccaaaacaagggcagcttccccggcttg
acaaacgtcagtgaggtggtgacagaccagttcctatgtagcgggatggagggagatgac
agtccttgcaaaggagaatccgggggagccgttttccttgagcggaggtacaggtttttc
caggtgggcctggtgagttggggtctttttgacccttgtcacggttcctccaacaaaaac
ttgcgcaggaagcctccgcatggcgttgtgcctagggacttccacatcagtctcttccgg
ctgcagccctggttgaggcagcacctggatggtgtcctcgactttttgcccctttaa

DBGET integrated database retrieval system