KEGG   Rattus norvegicus (rat): 24233
Entry
24233             CDS       T01003                                 

Symbol
C4a
Name
(RefSeq) complement C4 precursor
  KO
K03989  complement component 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno04936  Alcoholic liver disease
rno05133  Pertussis
rno05150  Staphylococcus aureus infection
rno05171  Coronavirus disease - COVID-19
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    24233 (C4a)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    24233 (C4a)
  09171 Infectious disease: bacterial
   05133 Pertussis
    24233 (C4a)
   05150 Staphylococcus aureus infection
    24233 (C4a)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    24233 (C4a)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    24233 (C4a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    24233 (C4a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24233 (C4a)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   24233 (C4a)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   24233 (C4a)
  Exosomal proteins of other cancer cells
   24233 (C4a)
SSDB
Motif
Pfam: TED_complement A2M A2M_recep A2M_BRD NTR MG2 MG3 ANATO MG4
Other DBs
NCBI-GeneID: 24233
NCBI-ProteinID: NP_113692
RGD: 620005
Ensembl: ENSRNOG00000047657
Vega: OTTRNOG00000001255
UniProt: P08649 Q6MG79
Position
20
AA seq 1737 aa
MRLLWGLAWAFSFFASSLQKPRLLLFSPSVVNLGTPLSVGVQLLDAPAGQEVKGSVYLRN
PTSGPCSPKKDFKLSSGNDFVLLRLEVPLKDVRSCGLFGLRRAPHIQLVAHSPWLKNTAS
KATETQGVNLLFSSRRGHIFVQTDQPIYNPGQRVRYRVFALDQKMRPSTDTLTVTVENSH
GLRVRKKEVFAPTSIFQDDFIIPDISEPGTWKISARFSDGLESNRSTHFEVKKYVLPNFE
VKLTPWKPYILTVPSYREEIQLDVQARYVYGKPVQGVAYTRFALMDEQGKKSFLRGLETQ
TKLVEGQTHISISRDQFQAALGKVNTEIGDLEGLRLYAAVAVIESPGGEMEEAELTSWPF
VSSAFSLDLSHTKQHLVPGAPFLLQALVREMSGSEASDVPVKVSATLLSGSDSKVLDFQQ
NTNGIGQVSFSIHVPPTITELRLLVSAGSLYPAVAKLTVQAPPSRGPGFLSIEPLDLRSP
RVGDTFVLSLRTVGIPMPTFSHYYYMIISRGQIMAMSREPRRALTSISVLVDHHLAPSFY
FVAYFYHQGLPVANSLLINVQPGDCEGKLELKVDGAKEYRNGDSMKLQLQTDSEALVALG
AVDTALYAVGGRSHKPLDMSKVFEVMNSYNLGCGPGGGDDALQVFQTAGLAFSDGDRLTQ
TKENLSCPKEKKSRQKRNVNFQKAISEKLGQYSSPDTKRCCQDGMTKLPMARTCEQRAAR
VPQPACREPFLSCCKFAEDLRRNQTRSQAGLARAQDMLQEEDLIDEDDILVRSFFPENWL
WRVEPVDRSKLLTVWLPDSLTTWEIHGVSLSKSKGLCVAKPTRVRVFREFHLHLRLPISV
RRFEQLELRPVLYNYLSEDVTVSVHVSPVEGLCLAGGGLLAQQVSVPAGSARPVAFSVVP
TAAASIPLKVVARGSFTIGDAVSKILQIEKEGAIHREEIVYNLDPLNNLGRSLEIPGSSD
PNVIPDGDFSSFVRVTASEPLETLGSEGALSPGGVASLLRLPRGCAEQTMIYLAPTLTAS
HYLDRTEQWSKLPPETKDHAVDLIQKGHMRIQQFRKKDGSFGAWLHRDSSTWLTAFVLKI
LSLAQEQIGDSPEKLQETAGWLLGQQLDDGSFHDPCPVIHRGMQGGLVGTDETVALTAFV
VIALHHGLAVFQDENSQQLKKRVEASITKANSFLGQKASAGLLGAHASAITAYALTLTKA
SEDLRNVAHNSLMAMAEETGENLYWGSAIGSQDNVVSSTPAPRNPSEPVPQAPALWIETT
AYGLLHLLLREGKGEMADKVATWLTHQGSFQGGFRSTQDTVVTLDALSAYWIASHTTEEK
ALNVTLSSMGRNGYKSHLLQLNNHQVKGLEEELKFSLGSTINVKVGGNSKGTLKILRTYN
VLDMKNTTCQDLRIEVTVTGYVEYTREANEDYEYDYDMPAADDPSVHSQPVTPLQLFEGR
RSRRRREAPKAADEQESRVQYTVCIWRNGNLGLSGMAIADITLLSGFQALRADLEKLTSL
SDRYVSHFETDGPHVLLYFDSVPTTRECVGFGALQEVAVGLVQPASAVLYDYYSPDHKCS
VFYAAPTKSKLLSTLCSADVCQCAEGKCPRQRRSLERGVEDKDGYRMKFACYYPRVEYGF
QVKVLREDSRAAFRLFETKITQVLHFTKDAKASIGQTRNFLVRASCRLRLEPSKEYLIMG
MDGVTSDLKGDPQYLLDSNTWIEEMPSERLCRSTRQRAACGQLNDFLQEYSSQGCQV
NT seq 5214 nt   +upstreamnt  +downstreamnt
atgcggctcctctggggcctggcctgggcattcagcttcttcgcctcctctctgcagaag
cccaggttgctcctgttctccccttctgtggttaatttggggacccccctgtcagtaggg
gtgcagctcctggatgcccctgcaggacaggaggtgaaaggctcagtgtacctcagaaac
ccaacaagcggtccctgctccccaaagaaggactttaagctcagctcgggaaatgacttt
gtgcttctcagacttgaggtcccactgaaagatgtgaggagttgtggcctctttggcctg
cgcagagccccccacatccagctggtggctcactctccgtggctaaagaacacagcatcc
aaagccaccgagactcagggggtcaacctgcttttctcttcccgacgaggccacatcttt
gtgcagaccgatcagcctatctataaccctgggcagcgggttcgttatcgggtctttgca
ctggatcaaaagatgcgtccatctactgacaccctcacggtcacagtggagaactcccat
ggcctccgtgtacgcaagaaggaggtatttgcccccacatccatcttccaagatgacttc
ataattccagacatctcagagccggggacctggaagatctcagctaggttctcagatggc
ctcgagtccaacagaagcacccacttcgaagtgaagaaatatgtccttcccaactttgag
gtgaagcttactccttggaagccatatatcctgacagtgcctagctaccgtgaagaaata
caattagacgtccaggccagatacgtctacgggaagcccgtgcagggcgtggcatatacc
cgcttcgcactcatggatgagcaggggaagaagtctttcctccggggcctagagacccag
accaagttggtggaaggccagactcacatctccatctcaagggaccagttccaggctgcc
ctgggtaaagtgaatactgagatcggagacctggaggggctgcggctctacgctgccgta
gctgtcattgagtctccaggaggagagatggaggaggcggagctcacatcctggcccttc
gtgtcatctgccttctccttggatctcagccacaccaagcagcatcttgtgcccggggcc
cccttcctgctgcaggccctggttcgagaaatgtcaggctctgaagcctctgatgttcct
gtcaaagtctctgccacattgttgtctgggtccgactcgaaagtccttgactttcaacag
aacaccaatgggattggccaagtcagcttttccatccatgtcccgccaaccatcaccgaa
cttcgactcttggtatctgccggttccctctacccagctgtagccaagctcaccgtgcaa
gccccaccttcaagaggccccggctttctgtccattgagccattagaccttcggtcccct
cgtgtgggggacaccttcgtcctgagccttcgaaccgtgggcatccctatgcctaccttc
tctcattactactacatgatcatctccagaggccagatcatggccatgagtcgggagccc
aggagggccctgacctccatctctgtcttggtggaccatcacctggctccctctttctac
tttgtggcctacttctatcaccaaggactcccagtggccaactccctgctcatcaacgtc
cagcccggggactgtgagggcaagctggaattgaaggtggatggtgccaaggagtatcgc
aatggagacagcatgaagctccaacttcaaactgactctgaagccctggtggcactggga
gctgtggacacagctctgtatgctgtgggtggccggtctcacaaacccctcgacatgagc
aaggtctttgaagtaatgaacagctacaaccttggctgtggtcccggaggcggggacgat
gcccttcaggtgttccagactgctggtctggccttttctgacggtgatcgactaactcag
accaaagagaacctgagctgtcccaaggagaagaaaagtcggcaaaagcgaaatgttaac
ttccagaaggctattagcgagaagttgggccagtattcctctccagacaccaagcgctgc
tgccaggatgggatgaccaagctgcccatggcacgcacctgcgagcagagggcagcccgc
gtgcctcagccagcctgccgggagcccttcttgtcctgttgcaagtttgctgaggacctc
cgcaggaaccagaccaggagccaggcgggcctcgcccgagcccaggacatgctgcaggag
gaggatctgatagatgaagatgacattctcgtgcgcagcttcttcccagagaactggctc
tggagagtggaacctgtggaccgctccaaactgttgactgtgtggctccctgactctctg
accacatgggagattcatggtgtgagcctgtccaaaagcaaaggcttgtgtgtagccaag
ccaactcgcgtgcgagtgttccgagaattccacctgcacctgcgcctgcccatctctgtc
cggcgcttcgagcagcttgaattacggcccgttctctacaactatctgagtgaggacgtg
actgtaagtgtccatgtgtccccagtggaggggctgtgcctggctggtggtggattgctg
gcccagcaagtatcagtgcctgcaggctccgcccggcctgtggccttctctgtggtaccc
acagctgctgccagcatacccctgaaagtggtggctcgggggtcttttactataggggat
gctgtgtctaagattctccaaattgagaaggaaggggccatccacagagaagagatagtc
tacaacctcgaccccctaaataaccttggtcggagtttggaaatccctggcagctcagac
cccaacgtcattcctgatggagatttcagcagcttcgtcagggttacagcctccgaaccc
ttggagactttgggctccgaaggcgccttgtccccaggcggagtggcctccctcctgagg
ctccctagaggctgtgcagaacaaaccatgatctatttggcccctaccctgactgcttcc
cactacctggacaggacggagcagtggagcaaactgccccctgagacaaaggaccatgct
gtggatctgattcagaaaggccacatgcggatccagcagtttcggaagaaagatggctcc
tttggggcatggttacaccgggacagcagcacctggctcacggcttttgtgctgaagatt
ctgagtctggcccaggaacagattggtgactcccccgagaagctgcaagagaccgctggg
tggctgctgggccagcagctggacgatggctcattccacgacccgtgtccagtcatccac
agaggcatgcaggggggcttggtgggaaccgatgagaccgtggcactgaccgcctttgtg
gtcatcgcccttcaccacgggctggccgtcttccaggacgagaactcacagcagctgaag
aagagggtggaagcctccatcacgaaggcgaactcgttcttggggcagaaggcaagtgct
gggctcctgggtgcacacgcatccgccatcacagcctatgccctgacactgaccaaggcc
tcggaggacctgcggaatgttgcccacaacagcctgatggccatggctgaggaaacaggg
gaaaacctctactggggctcagccattggctctcaggacaacgttgtgtcgtccacccca
gcccctcgtaatccctcagaacctgtgccccaggccccagccctgtggatcgaaaccaca
gcctacggcctgctacatctgctgctgcgggaggggaagggagaaatggctgacaaggtg
gcaacctggctcacacaccagggaagcttccaagggggattccgcagtacccaggacact
gtggtcaccctggatgccctgtctgcatactggatcgcttcacacaccaccgaggagaag
gcactcaatgtgactctcagctccatgggccgcaatgggtacaagtcccacctgctacag
ctgaacaaccaccaagtcaagggcctggaggaggagctgaagttctccctgggcagcacc
atcaatgtgaaagtgggaggaaacagcaaaggcaccttaaagatccttcgtacctacaac
gtcctggacatgaagaacacaacatgccaagaccttcggatagaagtgacggtcacaggc
tatgtggaatatacaagggaggccaacgaagactatgaatacgactatgatatgccagcc
gcagatgaccccagtgtccactcgcagcctgtgacacccctgcagctgtttgagggtcgt
cggagccgccgcaggagggaggcccccaaggctgcggatgagcaggagtccagagtgcag
tacaccgtgtgcatctggcggaacggtaacctggggctgtctgggatggccattgctgac
atcaccctcctgagtggattccaagccctgagggccgacctggagaagctgacctccctc
tctgaccgttacgtgagtcactttgagaccgacgggccccacgtcctactatactttgac
tcggtcccgaccacccgggagtgtgtgggctttggagccttgcaggaggtggccgtgggg
ctggtgcagccagccagtgctgtcctatatgactactacagccctgatcacaagtgctct
gtgttctatgctgcacccaccaagagcaagctcctctccaccttgtgctctgcagacgtc
tgccagtgcgctgaagggaagtgtcctcgacagcgaaggtcactggagcgaggggtggag
gacaaggatggttaccggatgaagttcgcctgctattatccccgagtggagtatggcttc
caggttaaggttctccgagaagacagcagagctgccttccgcctctttgagaccaagatc
acccaagtcctgcatttcacaaaggatgccaaggcctccataggtcagacccgcaacttt
ctggtccgggcctcttgccgccttcgtttggagcctagcaaagagtacttaatcatgggg
atggacggagtcaccagtgacctcaagggagacccccagtacttgctggactcaaatact
tggatcgaggagatgccatctgagcgcctgtgcaggagcacccgtcagcgggcagcctgt
ggccagctcaatgactttctgcaggagtacagcagccaggggtgccaggtgtga

KEGG   Rattus norvegicus (rat): 406161
Entry
406161            CDS       T01003                                 

Symbol
C4b
Name
(RefSeq) complement component 4, gene 2 precursor
  KO
K03989  complement component 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno04936  Alcoholic liver disease
rno05133  Pertussis
rno05150  Staphylococcus aureus infection
rno05171  Coronavirus disease - COVID-19
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    406161 (C4b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    406161 (C4b)
  09171 Infectious disease: bacterial
   05133 Pertussis
    406161 (C4b)
   05150 Staphylococcus aureus infection
    406161 (C4b)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    406161 (C4b)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    406161 (C4b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    406161 (C4b)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    406161 (C4b)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   406161 (C4b)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   406161 (C4b)
  Exosomal proteins of other cancer cells
   406161 (C4b)
SSDB
Motif
Pfam: TED_complement A2M A2M_recep A2M_BRD NTR MG2 MG3 ANATO MG4
Other DBs
NCBI-GeneID: 406161
NCBI-ProteinID: NP_001002805
RGD: 1591983
Ensembl: ENSRNOG00000030729
Vega: OTTRNOG00000001256
UniProt: Q6MG90
Position
20
AA seq 1737 aa
MRLLWGLAWAFSFFASSLQKPRLLLFSPSVVNLGTPLSVGVQLLDAPAGQEVKGSVYLRN
PTSGPCSPKKDFKLSSGNDFVLLRLEVPLEDVRNCGLFDLRRAPHIQLVAYSPWLKNTAP
KATETQGVNLLFSSRRGHIFVQTDQPIYNPGQRVRYRVFALDQKMRPSTDTLTVTVENSH
GLRVRKKVVFAPTSIFTDDFVIPDISEPGTWKISARFSDGLESNRSTHFEVKKYVLPNFE
VKLTPWKPYILTVPSYREEIQLDIQARYVYGKPVQGVAYTRFALMDEQGKKTFLRGLETQ
TKLVEGQTHISISRDQFQAALGKVNTEIGDLEGLRLYAAVAVIESPGGEMEEAELTSWPF
VSSAFSLDLSHTKQHLVPGAPFLLQALVREMSGSEASDVPVKVSATLLSGSDSKVLDFQQ
NTNGIGQVSFSIHVPPTITELRLLVSAGSLYPAVAKLTVQAPPSRGPGFLSIEPLDLRSP
RVGDTFILNLRTVGIPVPTFSHYYYMIISRGQIMAMSREPRTTLTSISVLVDHHLAPSFY
FVAYFYHQGLPVANSLLINVQPGDCEGKLELKVDGAKEYRNGESMKLQLQTDSEALVALG
AVDTALYAVGGRSHKPLDMSKVFEVMNSYNLGCGPGGGDDALQVFQTAGLAFSDGDRLTQ
TKEDLSCPKEKISRQKRNVNFQKAISEKLGQYSSPDTKRCCQDGMTKLPMARTCEQRAAR
VPQPACREPFLSCCKFAEDLRRNQTRSQAGLARAQNVMQEEDLIDEDDILVRSFFPENWL
WKVEPVDRSKLLTVWLPDSLTTWEIHGVSLSKSKGLCVAKPTRVRVFREFHLHLRLPISV
RRFEQLELRPVLYNYLSEDVTVSVHVSPVEGLCLAGGGLLAQQVSVPAGSARPVAFSVVP
TAAASMPLKVVARGSFDIGDAVSKILQIEKEGAIHREEIVYNLDPLNNLGRSLEIPGSSD
PNVIPDGDFSSFVRVTASEPLETLGSEGALSPGGVASLLKLPTGCAEQTMVLLAPTLTAS
RYLDRTEQWSKLPPETKDHAVDLIQKGHMRIQQFRKKDGSFGAWLDRDSSTWLTAFVLKI
LSLAQEQIGDSPEKLQETAGWLLGQQLDDGSFHDPCPVIQRGMQGGLVGTDETVALTAFV
VIALHHGLAVFQDENSQQLKKRVEASIMKANSFLGQKASAGLLGAHASAITAYALTLTKA
SEDLRNVAHNSLMAMAEETGENLYWGLAIGSQDNVVSSTAAPRNPSEPVPQAPALWIETT
AYGLLHLLLREGKGEMADKAATWLTHQGSFQGGFRSTQDTVVALDALSAYWIASHTTEEK
ALNVTLSSMGRNGYKSHLLQLNNHQVKGLEEELKFSLGSTINVKVGGNSKGTLKILRTYN
VLDMKNTTCQDLRIEVTITGYVEYTREANEDYEYDYDMPAADDPSVHSQPVTPLQLFEGR
RSRRRREAPKAADEQESRVQYTVCIWRNGNLGLSGMAIADITLLSGFQALRADLEKLTSL
SDRYVSHFETDGPHVLLYFDSVPTTRECVGFGALQEVAVGLVQPASAVLYDYYSPDHKCS
VFYAGPTKSKLLSTLCSADVCQCAEGKCPRQRRSLERGVEDKDGYRMKFACYYPRVEYGF
QVKVLREDSRSAFRLFETKITQVLHFTKDAKASIGQTRNFLVRASCRLRLEPSKEYLIMG
MDGVTSDLKGDPQYLLDSNSWIEEMPSERLCRSTRQRAACGQLNDFLQEYRSQGCQV
NT seq 5214 nt   +upstreamnt  +downstreamnt
atgcggctcctctggggcctggcctgggcattcagcttcttcgcctcctctctgcagaag
cccaggttgctcctgttctccccttctgtggttaatttggggacccccctgtcagtaggg
gtgcagctcctggatgcccctgcaggacaggaggtgaaaggctcagtgtacctcagaaac
ccaacaagcggtccctgctccccaaagaaggactttaagctcagctcgggaaatgacttt
gtgcttctcagacttgaggtcccactggaagatgtgaggaattgtggcctctttgaccta
cgcagagccccccacatccagctggtggcttactctccgtggctaaagaacacagcaccc
aaagccaccgagactcagggggtcaacctgcttttctcttcccgacgaggccacatcttt
gtgcagaccgatcagcctatctataaccctgggcagcgggtacgttatcgggtctttgca
ctggatcaaaagatgcgtccatctacggacaccctcacggtcacagtagagaactcccat
ggcctccgtgtacgcaagaaggtggtatttgcccccacatccatcttcacagatgacttc
gtaattccagacatctcagagccggggacctggaagatctcagctaggttctcagatggc
ctcgagtccaacagaagcacccactttgaagtgaagaaatatgtccttcccaactttgag
gtgaagcttactccttggaagccatatatcctgacagtgcctagctaccgtgaagaaatc
cagttagacatccaggccagatacgtctacgggaagcccgtgcagggcgtggcatatacc
cgcttcgcactcatggatgagcaggggaagaagactttccttcggggcctagagacccag
accaagttggtggaaggccagactcacatctccatctcaagggaccagttccaggctgcc
ctgggtaaagtgaatactgagatcggagacctggaggggctgcggctctacgctgctgta
gctgtcattgagtctccaggaggagagatggaggaagcagagctcacatcctggcccttc
gtgtcatctgccttctccttggatctcagccacaccaagcagcatcttgtgcccggggcc
cccttcctgctgcaggccctggttcgagaaatgtcaggctctgaagcctctgatgttcct
gtcaaagtctctgccacattgttatctgggtccgactcgaaagtccttgactttcaacag
aacaccaacgggattggccaagtcagcttttctatccatgtcccgccaaccatcacagaa
cttcgactcttggtatctgccggttccctctacccagctgtagccaagctcactgtgcaa
gccccaccttcaagaggccctggctttctgtccattgagccactagaccttcggtcccct
cgtgtgggggacaccttcatcctgaaccttcgaaccgtgggcatccctgtgcctaccttc
tctcattactactacatgatcatctccagaggccagatcatggccatgagtcgggagccc
aggacgaccctgacctccatctctgtcttggtggaccatcacctggctccctctttctac
tttgtggcctacttctatcaccaaggactcccagtggccaactccctgctcatcaatgtc
cagcctggggactgtgagggcaagctggaattgaaggtggacggtgccaaggagtatcga
aatggggagagcatgaagctccaacttcaaactgactccgaagccctggtggcactggga
gctgtggacacagctctgtatgctgtgggtggccggtctcacaaacccctcgacatgagc
aaggtctttgaagtaatgaacagttataaccttggctgtggtcctggaggtggggacgat
gcccttcaggtgttccagactgctggtttggccttttctgacggtgatcgactaactcag
accaaagaggacttgagctgtcccaaggagaagataagtcggcaaaagagaaatgttaac
ttccagaaggctattagcgagaagttgggccagtattcctctccagacaccaagcgctgc
tgccaggatgggatgaccaagctgcccatggcacgcacctgcgagcagcgggcagcccga
gtgcctcagccggcctgccgggagcccttcttgtcctgttgcaagtttgctgaggacctc
cgcaggaaccagaccaggagccaggcgggcctcgcccgagcccagaacgtgatgcaggag
gaggatctgatagatgaagatgacattcttgtgcgcagcttcttcccagagaactggctc
tggaaagtggaacctgtggaccgctccaaactgttgactgtgtggctccctgactctctg
accacatgggagattcatggtgtgagcctgtccaaaagcaaaggcctgtgtgtagccaag
ccaactcgcgtgcgagtgttccgagaattccacctgcacctgcgcctgcccatctctgtc
cggcgcttcgagcagcttgaattacggcccgttctctacaactatctgagtgaggacgtg
actgtgagtgtccatgtgtccccagtggaggggctgtgcctggctggtggtggattgctg
gcccagcaggtatcagtgcctgcaggctccgcccggcctgtggccttctctgtggtaccc
acagctgctgccagcatgcccctgaaagtggtggctcgggggtcttttgatataggggat
gctgtgtctaagattctccaaattgagaaggaaggggccatccacagagaagagatagtc
tacaacctcgaccccctaaataaccttggtcggagtttggaaatccctggcagctcagac
cccaacgtcattcctgatggagatttcagcagcttcgtcagggttacagcctccgaaccc
ttggagactttgggctctgaaggcgccttgtccccagggggagtggcctccctcctgaag
ctccccacgggctgcgcagaacaaaccatggtccttttggcccctaccctgactgcttcc
cgctacctggacaggaccgagcagtggagcaaactgccccctgagacaaaggaccatgct
gtggatctgatccagaaaggccacatgcggatccagcagtttaggaagaaagatggctcc
tttggggcgtggttagaccgggacagcagcacctggctcacggcctttgtgctgaagatt
ctgagtctggcccaggaacagattggtgactcccccgagaagctgcaagagaccgccggg
tggctgctgggccagcagctggacgatggctcattccacgacccgtgtccggtcattcaa
agaggcatgcaggggggcttggtggggaccgacgagacagtggcactgaccgcctttgtg
gtcatcgcccttcaccacgggctggccgtcttccaagacgagaactcgcagcagctgaag
aagagggtggaagcctccatcatgaaggcaaactcgttcttggggcagaaggcaagtgct
gggctcctgggtgcacacgcatccgccatcacagcctatgccctgacactgaccaaggcc
tcggaggacctgcggaatgttgcccacaacagcctgatggccatggctgaggaaacaggg
gaaaacctctactggggcttagccattggctctcaggacaacgttgtgtcatccaccgca
gcccctcgtaatccctcagaacctgtgccccaggccccagccctgtggatcgaaaccaca
gcctacggcctgctacatctgctgctgcgggaggggaagggagaaatggctgacaaggcg
gcaacctggctcacacaccagggaagcttccaagggggattccgcagtacccaggacact
gtggtcgccctggatgccctgtctgcatactggatcgcttcacacaccaccgaggagaag
gcactcaatgtgactctcagctccatgggccgcaatgggtacaagtcccacctgctacag
ctgaacaaccaccaagtcaagggcctggaggaggagctgaagttctccctgggcagcacc
atcaatgtgaaagtgggaggaaatagcaaaggcaccttaaagatccttcgtacctacaat
gtcctggacatgaagaacacaacatgccaagaccttcggatagaagtgacaatcacaggc
tatgtggaatatacaagggaggccaacgaagactatgaatacgactatgatatgccagcc
gcagatgaccccagtgtccactcgcagcctgtgacacccctgcagctgtttgagggtcgt
cggagccgccgcaggagggaggcccccaaggctgcggatgagcaggagtccagagtgcag
tacaccgtgtgcatctggcggaacggtaacctggggctgtctgggatggccattgctgac
atcaccctcctgagtggattccaagccctgagggctgacctggagaagctgacctccctc
tctgaccgttacgtgagtcactttgagaccgacgggccccacgtcctactgtactttgac
tcggtcccgaccacccgggagtgtgtgggctttggagctttgcaggaggtggccgtgggg
ctggtgcagccagccagtgctgtcctgtatgactactacagccctgatcacaagtgctct
gtgttctatgctggacccaccaagagcaagctcctctccaccttgtgctctgcagacgtc
tgccagtgcgctgaagggaagtgtcctcgacagcgaaggtcactggagcgaggggtggag
gacaaggatggttaccggatgaagttcgcctgctattatccccgagtggagtatggcttc
caggttaaggttctccgagaagacagcagatctgccttccgcctctttgagaccaagatc
acccaagtcctgcatttcacaaaggatgccaaggcctccataggtcagacccgcaacttt
ctggtccgggcttcttgccgccttcgtttggagcctagcaaagagtacttaatcatgggg
atggacggagtcaccagtgacctcaagggagacccccagtacttgctggactcaaacagt
tggatcgaggagatgccatctgagcgcctgtgcaggagcacccgtcagcgggcagcctgt
ggccagctcaatgacttcctgcaggagtacagaagccaggggtgccaggtgtga

DBGET integrated database retrieval system