KEGG   Rattus norvegicus (rat): 24237
Entry
24237             CDS       T01003                                 

Symbol
C6
Name
(RefSeq) complement component C6 precursor
  KO
K03995  complement component 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno05020  Prion disease
rno05171  Coronavirus disease - COVID-19
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    24237 (C6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    24237 (C6)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    24237 (C6)
  09164 Neurodegenerative disease
   05020 Prion disease
    24237 (C6)
SSDB
Motif
Pfam: MACPF Sushi TSP_1 TSP1_spondin Ldl_recept_a
Other DBs
NCBI-GeneID: 24237
NCBI-ProteinID: NP_788263
RGD: 2238
Ensembl: ENSRNOG00000024115
UniProt: Q811M5
Position
2
AA seq 934 aa
MTRHLTLCFILLIILIDKSEACFCDHYPWTHWSSCSKSCNSGTQSRQRQIVVNDYYRDNS
CDQLCTKQETRQCNVETCPINCVLGDYGTWSDCDPCIRKQVKVRSVLRPSQFGGQPCTEP
LVTFQPCVPSELCKIEETDCKNKFLCDSGRCIPSKLKCNGENDCGDNSDERNCGRTKPVC
SRTYTPIPSVQLMGAGFHFLAGEPRGDVPDNSFTGGICKSVRSSRTSNPHRVPANLENVN
FEVQTIEDDLKTDFYKDLATIGKNKNEDRSLSGEKKDSFYVPIFYSSKKSENFQRNSGFK
NAIEASHKKDSSFVRIHKVIKVLNFTMKTTDLQLSDVFLKALIHLPLEYNFALYSRIFDD
FGTHYFTSGSLGGKYDLLYQFSRQELQNSGLTEEETRNCVRYETKKRFLFFTKTYKEDRC
TTNRLSEKYKGSFLQGSEKSISLVQGGRSQQAAALAWEKGSSGPEANVFSEWLESVKENP
AVVDYELAPIIDLVRNIPCAVTKRNNLRKALQEYAAKFDPCQCAPCPNNGRPRLSGTECL
CVCQSGTYGENCEKRSPDYKSNAVDGNWGCWSSWSACNAAYRRSRSRECNNPEPQRGGQR
CEGKHWQEEDCTFSIMEKVGQPCISDDEEIKEVDLAEPEADSGCPQPPLPENAFVWNEKK
LYSVGEEVEISCLTGFKAVGYQYFRCLPDRTWRQGDVECQRTECLKPVVQDVLTISPFQS
VYKIGESIELTCPRGFVVAGPSRYTCKGDSWTPPIPNSLSCEKDILTKSKGLCQPGQKQS
GSECVCMSPEEDCSSYSEDLCIFDEGSSQYFTSSACKFLAEKCLNSNQFHFVHAGSCQEG
PQLEWGLERLKLAMKSTKRVPCGYDTCYDWEKCSAHTSNCVCLLPPQCPKDENQLHCVKM
GSSMRGKTVNICTLGAVRCANRKVEILNPGRCLD
NT seq 2805 nt   +upstreamnt  +downstreamnt
atgaccagacatctcaccttgtgtttcattttgctgatcatactgattgacaagagtgaa
gcctgtttctgtgaccactacccatggactcactggtccagctgttctaagtcctgcaat
tctggaacccagagcagacagagacaaatcgtagtgaacgattactatcgggataactca
tgcgatcagctctgtaccaagcaggagaccagacagtgcaacgtggagacatgtcccatc
aactgtgtcctaggagactatggaacatggtcagactgtgacccttgtattagaaaacag
gttaaagttagatctgttctgcgcccaagtcagtttgggggacaaccatgcacagagccc
ctggtgacctttcaaccatgtgtcccatctgagctctgcaaaattgaagagactgattgc
aagaataaattcctctgtgacagtgggcgctgtattcccagcaagttaaaatgcaatgga
gaaaatgactgtggagacaattcagacgaaaggaactgtgggaggacaaagccagtatgc
tcacggacatacactcctatccccagtgtgcagctgatgggcgctgggtttcattttctg
gcaggagagcccagaggagatgtccctgataactccttcactggaggaatatgtaaatcc
gtcaggagcagccgaacgagtaatccacaccgagttccagccaatctggaaaatgtcaac
tttgaggtacaaactatagaagatgacttgaaaacagatttctacaaggatttagccact
attggaaaaaataaaaatgaagaccgttcattgtctggtgagaagaaagactctttctac
gtaccaattttttattcctcaaagaaaagtgaaaatttccaacgtaactcaggcttcaaa
aacgccattgaagcctcccacaagaaggattcgagctttgttaggatccataaagtgata
aaagtcttaaacttcacaatgaaaacgacagacctgcagctctcagacgtcttcctaaaa
gccctcatccacctgcctttagaatacaactttgctttgtacagccggatatttgatgac
tttgggacccactatttcacctcaggctcccttgggggcaagtatgaccttctctaccaa
ttcagccgccaggagctacagaactcaggtttaacagaagaagaaactcgaaactgtgtc
cggtatgaaacaaagaaacgtttcttattttttacgaaaacatacaaggaagaccggtgt
accacaaataggctgtctgaaaagtacaaaggttcctttttacagggatcggagaaatct
atatccctggtccagggcgggaggagtcagcaggcagcagccttggcttgggagaagggc
agctctggtccagaggcgaatgtcttctctgagtggttagagtcggtgaaggaaaaccct
gctgtggttgattatgagcttgctccgatcatcgacttggtcagaaacatcccatgtgca
gtgacaaaacggaacaacctcaggaaagcccttcaagaatatgcagccaagtttgaccct
tgccaatgtgctccatgtcctaataatggccgccccaggctctcaggcacagaatgtttg
tgtgtgtgccagagtggtacctacggtgagaactgtgaaaaacggtccccagattataaa
tcgaatgcagtggatgggaactggggctgctggtcttcctggagcgcatgcaatgctgct
tataggaggtcaaggagccgggagtgtaataaccctgagccacagcgaggagggcagcgc
tgtgagggcaagcattggcaagaagaagactgtacattctcaataatggaaaaagttgga
caaccgtgcatcagtgatgatgaagaaataaaagaagtagaccttgctgagccagaagca
gattcagggtgtcctcagccacctctcccagaaaatgcatttgtctggaatgaaaagaaa
ctgtactcagtcggggaggaagttgaaatttcatgtctcactggattcaaagctgtggga
taccagtacttcagatgcttaccagacagaacctggaggcaaggggatgtcgaatgccaa
cggaccgagtgcctcaaaccagtcgttcaggatgtcctgaccatctccccatttcagagt
gtgtacaagattggggaatccattgagctgacctgtcccagaggctttgttgttgctggc
ccatcgaggtatacatgcaagggagactcctggacacctcccattccaaattcactgagc
tgtgaaaaagatattctgacaaagtcaaagggcctttgtcaaccaggacaaaagcaatca
ggatccgagtgtgtttgtatgtccccagaagaagactgtagcagttattcggaagatctc
tgtatatttgatgagggatccagtcagtacttcacttcatctgcttgcaaatttttggct
gaaaaatgtttaaacagcaaccagttccactttgtccatgctggttcctgccaagaaggc
ccacagttagaatggggtcttgagaggctaaaactcgcaatgaagagcacaaagagagtg
ccctgtggatatgatacttgctatgactgggaaaaatgttcagcccacacctccaactgt
gtctgcctattgcccccacaatgccccaaggatgaaaaccaactccactgtgtcaaaatg
ggatcatcaatgcgtgggaaaacagtaaacatctgtacactgggagccgtgaggtgtgca
aacaggaaggtggaaatactgaatcctgggaggtgcttggattag

DBGET integrated database retrieval system