KEGG   Rattus norvegicus (rat): 24311
Entry
24311             CDS       T01003                                 

Symbol
Ddc
Name
(RefSeq) aromatic-L-amino-acid decarboxylase isoform a
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00350  Tyrosine metabolism
rno00360  Phenylalanine metabolism
rno00380  Tryptophan metabolism
rno01100  Metabolic pathways
rno04726  Serotonergic synapse
rno04728  Dopaminergic synapse
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05034  Alcoholism
Module
rno_M00037  Melatonin biosynthesis, animals, tryptophan => serotonin => melatonin
rno_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    24311 (Ddc)
   00360 Phenylalanine metabolism
    24311 (Ddc)
   00380 Tryptophan metabolism
    24311 (Ddc)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    24311 (Ddc)
   04726 Serotonergic synapse
    24311 (Ddc)
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    24311 (Ddc)
   05031 Amphetamine addiction
    24311 (Ddc)
   05034 Alcoholism
    24311 (Ddc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24311 (Ddc)
Enzymes [BR:rno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     24311 (Ddc)
    4.1.1.105  L-tryptophan decarboxylase
     24311 (Ddc)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   24311 (Ddc)
SSDB
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2
Other DBs
NCBI-GeneID: 24311
NCBI-ProteinID: NP_001257781
RGD: 2494
Ensembl: ENSRNOG00000004327
UniProt: P14173
Position
14
AA seq 480 aa
MDSREFRRRGKEMVDYIADYLDGIEGRPVYPDVEPGYLRALIPTTAPQEPETYEDIIRDI
EKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMD
WLGKMLELPEAFLAGRAGEGGGVIQGSASEATLVALLAARTKMIRQLQAASPELTQAALM
EKLVAYTSDQAHSSVERAGLIGGVKIKAIPSDGNYSMRAAALREALERDKAAGLIPFFVV
VTLGTTSCCSFDNLLEVGPICNQEGVWLHIDAAYAGSAFICPEFRYLLNGVEFADSFNFN
PHKWLLVNFDCSAMWVKKRTDLTEAFNMDPVYLRHSHQDSGLITDYRHWQIPLGRRFRSL
KMWFVFRMYGVKGLQAYIRKHVKLSHEFESLVRQDPRFEICTEVILGLVCFRLKGSNQLN
ETLLQRINSAKKIHLVPCRLRDKFVLRFAVCSRTVESAHVQLAWEHIRDLASSVLRAEKE
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggattcccgtgaattccggagaagagggaaggagatggtggattatatagctgactat
ctggacggcattgagggacgtccagtgtaccctgacgtggagcctggctaccttcgggcc
ctgatccccaccactgccccccaggagccagaaacatatgaggacataatcagagacatt
gaaaagataatcatgccaggggtcacacactggcacagcccctacttcttcgcttacttc
cccacggccagctcctacccagctatgcttgcggacatgctgtgcggggctatcggctgc
attggcttctcctgggctgcaagcccagcatgcacagagctggagacagtgatgatggat
tggctggggaagatgcttgagctgccagaggcctttttggctggaagagctggggaaggg
ggaggagtgatccagggaagtgccagcgaagccaccttggtggccctactggctgctcgg
actaaaatgatccgccagctgcaggcagcctccccagagctgacacaagctgctctcatg
gaaaagcttgtcgcttacacatctgatcaggcacattcctccgtagaaagagctggatta
attggtggagtcaaaataaaagcaattccttcagatggcaactactccatgagagctgct
gcccttcgggaggccctggagagagacaaggcggctggcctgattcctttcttcgtggtt
gtcaccctaggaaccacatcttgctgctcttttgacaatctcctagaagtgggtcccatc
tgcaaccaggagggtgtatggctgcacattgatgctgcatacgcaggcagtgcctttatc
tgtcctgagttccggtatcttctgaatggcgtggagtttgcagattcctttaactttaat
ccccacaagtggcttttggtgaattttgactgctctgccatgtgggtgaagaagagaact
gacctaaccgaagcctttaatatggaccctgtttatctgaggcacagtcaccaggactca
ggactcatcactgactacaggcactggcaaatcccactggggcgaagatttcgctccctg
aaaatgtggtttgtttttagaatgtacggagtcaaggggctgcaggcttacattcgaaag
cacgtgaagctgtctcatgagtttgagtccctggtacgccaggaccctcgctttgaaatt
tgcacggaagtcatcctcgggttggtctgcttccggctaaagggctccaaccagttgaac
gaaactctcttacaaagaataaacagcgccaaaaaaatccacttggttccgtgtcgtctc
cgagacaagtttgtgctgcgctttgcggtgtgctcccgcactgtggagtctgcccacgtg
cagctggcctgggagcacatccgagatctagcgagcagtgtgctgagggcagagaaagag
taa

DBGET integrated database retrieval system