KEGG   Rattus norvegicus (rat): 24408
Entry
24408             CDS       T01003                                 

Gene name
Grin1
Definition
(RefSeq) glutamate receptor ionotropic, NMDA 1 isoform 1a precursor
  KO
K05208  glutamate receptor ionotropic, NMDA 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04713  Circadian entrainment
rno04720  Long-term potentiation
rno04724  Glutamatergic synapse
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05033  Nicotine addiction
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    24408 (Grin1)
   04015 Rap1 signaling pathway
    24408 (Grin1)
   04020 Calcium signaling pathway
    24408 (Grin1)
   04024 cAMP signaling pathway
    24408 (Grin1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24408 (Grin1)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    24408 (Grin1)
   04720 Long-term potentiation
    24408 (Grin1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    24408 (Grin1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    24408 (Grin1)
   05014 Amyotrophic lateral sclerosis
    24408 (Grin1)
   05016 Huntington disease
    24408 (Grin1)
   05017 Spinocerebellar ataxia
    24408 (Grin1)
   05020 Prion disease
    24408 (Grin1)
   05022 Pathways of neurodegeneration - multiple diseases
    24408 (Grin1)
  09165 Substance dependence
   05030 Cocaine addiction
    24408 (Grin1)
   05031 Amphetamine addiction
    24408 (Grin1)
   05033 Nicotine addiction
    24408 (Grin1)
   05034 Alcoholism
    24408 (Grin1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    24408 (Grin1)
Ion channels [BR:rno04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   24408 (Grin1)
SSDB
Motif
Pfam: Lig_chan ANF_receptor Lig_chan-Glu_bd SBP_bac_3 CaM_bdg_C0 Peripla_BP_6 Ion_trans_2
Other DBs
NCBI-GeneID: 24408
NCBI-ProteinID: NP_058706
RGD: 2736
Ensembl: ENSRNOG00000011726
UniProt: P35439
Structure
PDB: 

Position
3
AA seq 938 aa
MSTMHLLTFALLFSCSFARAACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQL
NATSVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLG
LTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYNWNHIILLVSDDHEGRAAQKRL
ETLLEERESKAEKVLQFDPGTKNVTALLMEARELEARVIILSASEDDAATVYRAAAMLNM
TGSGYVWLVGEREISGNALRYAPDGIIGLQLINGKNESAHISDAVGVVAQAVHELLEKEN
ITDPPRGCVGNTNIWKTGPLFKRVLMSSKYADGVTGRVEFNEDGDRKFANYSIMNLQNRK
LVQVGIYNGTHVIPNDRKIIWPGGETEKPRGYQMSTRLKIVTIHQEPFVYVKPTMSDGTC
KEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVA
DGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTI
LVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKVNSEEEEEDA
LTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRP
EERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQA
VRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSH
ENGFMEDLDKTWVRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRH
KDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDT
STGGGRGALQNQKDTVLPRRAIEREEGQLQLCSRHRES
NT seq 2817 nt   +upstreamnt  +downstreamnt
atgagcaccatgcacctgctgacattcgccctgcttttttcctgctccttcgcccgcgcc
gcctgcgaccccaagatcgtcaacatcggcgcggtgctgagcacgcgcaagcatgaacag
atgttccgcgaggcagtaaaccaggccaataagcgacacggctcttggaagatacagctc
aacgccacttctgtcacccacaagcccaacgccatacagatggccctgtcagtgtgtgag
gacctcatctctagccaggtctacgctatcctagttagccacccgcctactcccaacgac
cacttcactcccacccctgtctcctacacagctggcttctacagaatccctgtcctggga
ctgactacccgaatgtccatctactctgacaagagtatccacctgagtttccttcgcacg
gtgccgccctactcccaccagtccagcgtctggtttgagatgatgcgagtctacaactgg
aaccacatcatcctgctggtcagcgacgaccacgagggacgggcagcgcagaagcgcttg
gagacgttgctggaggaacgggagtccaaggcagagaaggtgctgcagtttgacccagga
accaagaatgtgacggctctgctgatggaggcccgggaactggaggcccgggtcatcatc
ctttctgcaagcgaggacgacgctgccacagtgtaccgcgcagccgcaatgctgaacatg
acgggctctgggtacgtgtggctggtcggggaacgcgagatctctgggaacgccctgcgc
tacgctcctgatggcatcatcggacttcagctcatcaatggcaagaatgagtcagcccac
atcagtgacgccgtgggcgtggtggcacaggcagttcacgaactcctagagaaggagaat
atcactgacccaccgcggggttgcgtgggcaacaccaacatctggaagacaggaccattg
ttcaagagggtgctgatgtcttctaagtatgcggacggagtgactggccgtgtggaattc
aatgaggatggggaccggaagtttgccaactatagtatcatgaacctgcagaaccgcaag
ctggtgcaagtgggcatctacaatggtacccatgtcatcccaaatgacaggaagatcatc
tggccaggaggagagacagagaaacctcgaggataccagatgtccaccagactaaagata
gtgacaatccaccaagagcccttcgtgtacgtcaagcccacaatgagtgatgggacatgc
aaagaggagttcacagtcaatggtgacccagtgaagaaggtgatctgtacggggcctaat
gacacgtccccaggcagcccacgccacacagtgccccagtgctgctatggcttctgcata
gacctgctcatcaagctggcgcggaccatgaattttacctatgaggtgcacctggtggca
gatggcaagtttggcacacaggagcgggtaaacaacagcaacaaaaaggagtggaacgga
atgatgggcgagctactcagtggccaagcggacatgattgtggcaccactgaccatcaac
aatgagcgtgcgcagtacatagagttctccaagcccttcaagtaccagggcctgaccatt
ttggtcaagaaggagattcccaggagcacactggactcatttatgcagccttttcagagc
acactgtggttgctagtaggactgtcagttcatgtggtggctgtgatgctgtacctgctg
gaccgcttcagtccctttggccgattcaaggtgaacagtgaggaggaggaggaagatgca
ctgaccctgtcctctgccatgtggttttcctggggcgtcctgctcaactccggcattggg
gaaggtgccccccggagtttctctgcacgtatcctaggcatggtgtgggctggtttcgcc
atgatcatagtggcttcctacactgccaacttggcagctttcctggtgctggatcggcct
gaggagcgcatcacgggcatcaatgaccccaggctcagaaacccctcagacaagttcatc
tacgcaactgtaaagcagagctccgtggacatctacttccggaggcaggtggagttgagt
accatgtaccggcacatggaaaaacacaattacgagagcgcagctgaggccatccaggct
gtgcgggacaacaagctgcacgcctttatctgggactcggccgtgctggagtttgaggct
tcacagaagtgcgatctggtgaccacgggtgagctgttcttccgctcaggctttggcatc
ggcatgcgcaaggacagcccctggaagcagaacgtttccctgtccatactcaagtcccat
gagaatggcttcatggaagatctggataagacatgggttcggtatcaggaatgcgactcc
cgcagcaatgctcctgcaaccctcacttttgagaacatggcaggggtcttcatgctggtg
gctggaggcatcgtagctgggattttcctcattttcattgagatcgcctacaagcgacac
aaggatgcccgtaggaagcagatgcagctggcttttgcagccgtgaacgtgtggaggaag
aacctgcaggatagaaagagtggtagagcagagcccgaccctaaaaagaaagccacattt
agggctatcacctccaccctggcctccagcttcaagagacgtaggtcctccaaagacacg
agcaccgggggtggacgcggcgctttgcaaaaccaaaaagacacagtgctgccgcgacgc
gctattgagagggaggagggccagctgcagctgtgttcccgtcatagggagagctga

KEGG   Rattus norvegicus (rat): 24409
Entry
24409             CDS       T01003                                 

Gene name
Grin2a
Definition
(RefSeq) glutamate receptor ionotropic, NMDA 2A precursor
  KO
K05209  glutamate receptor ionotropic, NMDA 2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04713  Circadian entrainment
rno04720  Long-term potentiation
rno04724  Glutamatergic synapse
rno04728  Dopaminergic synapse
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05033  Nicotine addiction
rno05034  Alcoholism
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    24409 (Grin2a)
   04015 Rap1 signaling pathway
    24409 (Grin2a)
   04020 Calcium signaling pathway
    24409 (Grin2a)
   04024 cAMP signaling pathway
    24409 (Grin2a)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24409 (Grin2a)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    24409 (Grin2a)
   04728 Dopaminergic synapse
    24409 (Grin2a)
   04720 Long-term potentiation
    24409 (Grin2a)
  09159 Environmental adaptation
   04713 Circadian entrainment
    24409 (Grin2a)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    24409 (Grin2a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    24409 (Grin2a)
   05014 Amyotrophic lateral sclerosis
    24409 (Grin2a)
   05017 Spinocerebellar ataxia
    24409 (Grin2a)
   05020 Prion disease
    24409 (Grin2a)
   05022 Pathways of neurodegeneration - multiple diseases
    24409 (Grin2a)
  09165 Substance dependence
   05030 Cocaine addiction
    24409 (Grin2a)
   05031 Amphetamine addiction
    24409 (Grin2a)
   05033 Nicotine addiction
    24409 (Grin2a)
   05034 Alcoholism
    24409 (Grin2a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    24409 (Grin2a)
Ion channels [BR:rno04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   24409 (Grin2a)
SSDB
Motif
Pfam: NMDAR2_C Lig_chan Lig_chan-Glu_bd SBP_bac_3 ANF_receptor
Other DBs
NCBI-GeneID: 24409
NCBI-ProteinID: NP_036705
RGD: 2737
Ensembl: ENSRNOG00000033942
UniProt: Q00959
Structure
PDB: 

Position
10
AA seq 1464 aa
MGRLGYWTLLVLPALLVWRDPAQNAAAEKGPPALNIAVLLGHSHDVTERELRNLWGPEQA
TGLPLDVNVVALLMNRTDPKSLITHVCDLMSGARIHGLVFGDDTDQEAVAQMLDFISSQT
FIPILGIHGGASMIMADKDPTSTFFQFGASIQQQATVMLKIMQDYDWHVFSLVTTIFPGY
RDFISFIKTTVDNSFVGWDMQNVITLDTSFEDAKTQVQLKKIHSSVILLYCSKDEAVLIL
SEARSLGLTGYDFFWIVPSLVSGNTELIPKEFPSGLISVSYDDWDYSLEARVRDGLGILT
TAASSMLEKFSYIPEAKASCYGQAEKPETPLHTLHQFMVNVTWDGKDLSFTEEGYQVHPR
LVVIVLNKDREWEKVGKWENQTLSLRHAVWPRYKSFSDCEPDDNHLSIVTLEEAPFVIVE
DIDPLTETCVRNTVPCRKFVKINNSTNEGMNVKKCCKGFCIDILKKLSRTVKFTYDLYLV
TNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRS
NGTVSPSAFLEPFSASVWVMMFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFT
IGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEFVD
QVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPYMHQYMTRFNQRGVEDALVSL
KTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFATTGYGIALQKGSPWKRQIDLALL
QFVGDGEMEELETLWLTGICHNEKNEVMSSQLDIDNMAGVFYMLAAAMALSLITFIWEHL
FYWKLRFCFTGVCSDRPGLLFSISRGIYSCIHGVHIEEKKKSPDFNLTGSQSNMLKLLRS
AKNISNMSNMNSSRMDSPKRATDFIQRGSLIVDMVSDKGNLIYSDNRSFQGKDSIFGDNM
NELQTFVANRHKDNLSNYVFQGQHPLTLNESNPNTVEVAVSTESKGNSRPRQLWKKSMES
LRQDSLNQNPVSQRDEKTAENRTHSLKSPRYLPEEVAHSDISETSSRATCHREPDNNKNH
KTKDNFKRSMASKYPKDCSDVDRTYMKTKASSPRDKIYTIDGEKEPSFHLDPPQFVENIT
LPENVGFPDTYQDHNENFRKGDSTLPMNRNPLHNEDGLPNNDQYKLYAKHFTLKDKGSPH
SEGSDRYRQNSTHCRSCLSNLPTYSGHFTMRSPFKCDACLRMGNLYDIDEDQMLQETGNP
ATREEVYQQDWSQNNALQFQKNKLRINRQHSYDNILDKPREIDLSRPSRSISLKDRERLL
EGNLYGSLFSVPSSKLLGNKSSLFPQGLEDSKRSKSLLPDHASDNPFLHTYGDDQRLVIG
RCPSDPYKHSLPSQAVNDSYLRSSLRSTASYCSRDSRGHSDVYISEHVMPYAANKNTMYS
TPRVLNSCSNRRVYKKMPSIESDV
NT seq 4395 nt   +upstreamnt  +downstreamnt
atgggcagattgggctactggaccttgctggtattgccggcccttctggtctggcgcgat
ccggcgcagaacgcggcggcggagaagggtcctccagcgctgaacattgcggtgctgctg
ggtcacagccacgacgtgacagaacgcgaacttcgaaatctgtggggcccagagcaggca
accggcttgcccctggatgtgaacgtggtggcgttattgatgaaccgcactgaccctaag
agcctcatcacgcatgtgtgcgacctcatgtccggggcgcgcatccacggcttggtgttt
ggagatgacacggaccaggaggctgtggcccagatgctggattttatctcctcacagact
tttatccccatcttgggcattcatgggggtgcatctatgatcatggctgacaaggatccg
acatccacgttcttccagtttggagcctccatccagcagcaagccacagttatgctgaag
atcatgcaggactacgactggcacgtcttctccctggtcaccaccatcttccctggctac
cgagacttcatcagctttatcaagacaacagtggacaacagctttgtgggctgggatatg
cagaacgtgatcacactggacacctccttcgaggacgccaagacgcaggtccagctgaag
aagatccattcttctgtcatcctgctctactgctccaaagacgaggctgtcctcatcctg
agcgaggctcgctccctcggcctcactggctatgatttcttctggattgtccccagtttg
gtgtctgggaacacagagctcatccccaaagagtttccatcaggtctcatttcagtctct
tatgacgactgggactacagcctggaggcaagagtgagagacggtcttgggatcttaacc
actgccgcatcctccatgttggagaagttctcctacattcctgaggccaaggccagctgc
tatgggcaggcagagaagccagagaccccgctacacaccctgcaccaattcatggtcaat
gtgacttgggatggcaaggacttgtccttcactgaggaaggttaccaggtgcaccccagg
cttgtggtgatcgtgctgaacaaggaccgggagtgggaaaaggtgggcaagtgggagaac
cagacgctgagcctgaggcacgctgtgtggccaaggtacaagtccttttctgactgcgag
ccagatgacaaccacctcagcattgtcaccttggaggaagcccccttcgtcatcgtagag
gacatagaccccctgactgagacctgtgtgaggaacacggtgccctgtcggaagttcgtc
aagatcaacaattcaaccaacgaagggatgaatgtgaagaaatgctgcaaggggttctgc
atcgacatcctcaagaagctgtccagaactgtgaagttcacctatgacctctacctggtg
accaatgggaagcatgggaaaaaggttaacaatgtgtggaatggaatgataggtgaagtg
gtctatcaacgagcagtcatggctgtgggctcactcaccatcaatgaggagcgttcggaa
gtggtggacttctcggtgcccttcgtggagacaggaatcagcgtcatggtctccaggagt
aatggcactgtctccccttctgctttcctcgaacccttcagtgcctccgtctgggtgatg
atgtttgtgatgctgctcatcgtctcagccattgctgtcttcgtttttgaatacttcagt
cctgttggatacaacagaaacttagccaaagggaaagctccccacgggccttcttttact
attggaaaagctatatggctcctctggggcctggtcttcaacaattctgtgcctgtccag
aatcctaaaggcacaaccagcaagatcatggtgtcagtgtgggccttctttgctgtcatc
ttcctggccagttacacagccaacctggctgccttcatgatccaggaggagtttgtggac
caagtgactggcctcagtgacaagaagttccagagacctcatgactattctccacctttc
cgatttgggacggtacccaatggaagtacagagaggaatattcgtaacaactacccgtat
atgcaccagtacatgaccagattcaaccagaggggagtggaggatgccttggtcagcttg
aaaaccgggaagttggacgctttcatctatgacgcagccgtcttgaactacaaggccggg
agggatgaaggctgtaaactggtgaccattgggagcgggtacatctttgctaccacaggc
tatggaattgcgctgcagaagggctcaccctggaagaggcagattgacctcgctctgctc
cagtttgttggtgatggtgagatggaggagctggagacactgtggcttacgggcatctgc
cacaacgagaagaatgaggtgatgagtagccagctggacatcgataacatggcgggcgtg
ttctacatgctggctgcagccatggccctcagcctcatcaccttcatctgggagcacctc
ttctactggaagctgcgcttctgcttcacaggcgtgtgctctgaccggcccgggctgctc
ttctccatcagcaggggcatctatagttgcatccatggggtacacattgaagaaaagaag
aaatctccagatttcaatctgactggatcacagagcaacatgctaaagcttcttcggtca
gctaaaaacatctccaatatgtccaacatgaactcctcaagaatggactcacctaaaaga
gctactgacttcattcaaagagggtcacttattgtggacatggtttcagacaagggaaat
ttgatatattcagacaacagatcctttcaagggaaggacagtatatttggagacaacatg
aatgaactccaaacatttgtggccaacaggcacaaggataatctcagtaactatgtgttt
caaggacagcatcctctcactctcaatgagtccaaccctaacacagtagaggtggctgtc
agcactgaatccaaagggaactcccgaccccggcagctttggaagaaatccatggagtct
ctacgccaggattctctaaaccagaacccagtctcccagagggatgagaagactgcagag
aatcggacccactcgctaaagagtcctaggtatcttccagaagaggtagcccactctgac
atttcagaaacctcaagccgggccacatgccacagggagccagataacaataagaaccac
aagaccaaggataacttcaaacggtcaatggcctctaagtatcccaaggactgtagcgat
gttgaccgcacctacatgaaaaccaaagcaagttctcccagggataagatctataccatt
gatggtgagaaggagcccagcttccacttagatcctcctcagtttgttgagaatataacc
ctgcctgagaatgtgggcttcccagatacctaccaagatcacaatgagaacttccgcaag
ggggactccacactgcccatgaacaggaacccattacataatgaagacgggcttcccaac
aatgaccaatataaactctatgccaagcactttaccttgaaagacaagggttccccacac
agtgagggcagtgatcgataccggcagaactccacacattgcagaagctgcctttcgaat
ctgcccacctactcaggccactttaccatgaggtctcctttcaagtgtgatgcctgtctg
cggatggggaatctctatgacattgatgaagaccagatgcttcaggagacaggtaaccca
gctactcgggaggaggtctaccagcaggactggtcacagaacaacgccctccagttccag
aagaacaagctaaggattaaccgacagcactcctatgataacattctggacaaacccaga
gagatagaccttagcaggccctcccggagcataagcctcaaggacagggaacggctactg
gagggcaacttgtatgggagcctgttcagtgtcccctcaagcaaactcttggggaacaaa
agctcccttttcccccaaggtctggaggacagcaagaggagcaagtctctcttgccagac
cacgcctccgataatcctttcctccacacgtatggggatgaccaacgcttagttatcggg
agatgtccctcggacccttacaaacactcattgccatcacaggcggtaaatgacagctat
cttcggtcatccttgaggtcaacagcatcatattgctccagggacagtcggggccacagt
gatgtgtatatttcagagcatgttatgccttatgctgcaaataagaataccatgtactct
acccccagggttttaaattcctgcagcaatagacgagtgtacaagaaaatgcctagtatc
gaatctgatgtttaa

KEGG   Rattus norvegicus (rat): 24410
Entry
24410             CDS       T01003                                 

Gene name
Grin2b
Definition
(RefSeq) glutamate receptor ionotropic, NMDA 2B precursor
  KO
K05210  glutamate receptor ionotropic, NMDA 2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04713  Circadian entrainment
rno04720  Long-term potentiation
rno04724  Glutamatergic synapse
rno04728  Dopaminergic synapse
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05033  Nicotine addiction
rno05034  Alcoholism
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    24410 (Grin2b)
   04015 Rap1 signaling pathway
    24410 (Grin2b)
   04024 cAMP signaling pathway
    24410 (Grin2b)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24410 (Grin2b)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    24410 (Grin2b)
   04728 Dopaminergic synapse
    24410 (Grin2b)
   04720 Long-term potentiation
    24410 (Grin2b)
  09159 Environmental adaptation
   04713 Circadian entrainment
    24410 (Grin2b)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    24410 (Grin2b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    24410 (Grin2b)
   05014 Amyotrophic lateral sclerosis
    24410 (Grin2b)
   05016 Huntington disease
    24410 (Grin2b)
   05017 Spinocerebellar ataxia
    24410 (Grin2b)
   05020 Prion disease
    24410 (Grin2b)
   05022 Pathways of neurodegeneration - multiple diseases
    24410 (Grin2b)
  09165 Substance dependence
   05030 Cocaine addiction
    24410 (Grin2b)
   05031 Amphetamine addiction
    24410 (Grin2b)
   05033 Nicotine addiction
    24410 (Grin2b)
   05034 Alcoholism
    24410 (Grin2b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    24410 (Grin2b)
Ion channels [BR:rno04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   24410 (Grin2b)
SSDB
Motif
Pfam: NMDAR2_C Lig_chan Lig_chan-Glu_bd SBP_bac_3 ANF_receptor
Other DBs
NCBI-GeneID: 24410
NCBI-ProteinID: NP_036706
RGD: 2738
Ensembl: ENSRNOG00000008766
UniProt: Q00960
Structure
PDB: 

Position
4
AA seq 1482 aa
MKPSAECCSPKFWLVLAVLAVSGSKARSQKSPPSIGIAVILVGTSDEVAIKDAHEKDDFH
HLSVVPRVELVAMNETDPKSIITRICDLMSDRKIQGVVFADDTDQEAIAQILDFISAQTL
TPILGIHGGSSMIMADKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQ
DFVNKIRSTIENSFVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEEATYI
FEVANSVGLTGYGYTWIVPSLVAGDTDTVPSEFPTGLISVSYDEWDYGLPARVRDGIAII
TTAASDMLSEHSFIPEPKSSCYNTHEKRIYQSNMLNRYLINVTFEGRNLSFSEDGYQMHP
KLVIILLNKERKWERVGKWKDKSLQMKYYVWPRMCPETEEQEDDHLSIVTLEEAPFVIVE
SVDPLSGTCMRNTVPCQKRIISENKTDEEPGYIKKCCKGFCIDILKKISKSVKFTYDLYL
VTNGKHGKKINGTWNGMIGEVVMKRAYMAVGSLTINEERSEVVDFSVPFIETGISVMVSR
SNGTVSPSAFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPSF
TIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYV
DQVSGLSDKKFQRPNDFSPPFRFGTVPNGSTERNIRNNYAEMHAYMGKFNQRGVDDALLS
LKTGKLDAFIYDAAVLNYMAGRDEGCKLVTIGSGKVFASTGYGIAIQKDSGWKRQVDLAI
LQLFGDGEMEELEALWLTGICHNEKNEVMSSQLDIDNMAGVFYMLGAAMALSLITFICEH
LFYWQFRHCFMGVCSGKPGMVFSISRGIYSCIHGVAIEERQSVMNSPTATMNNTHSNILR
LLRTAKNMANLSGVNGSPQSALDFIRRESSVYDISEHRRSFTHSDCKSYNNPPCEENLFS
DYISEVERTFGNLQLKDSNVYQDHYHHHHRPHSIGSTSSIDGLYDCDNPPFTTQPRSISK
KPLDIGLPSSKHSQLSDLYGKFSFKSDRYSGHDDLIRSDVSDISTHTVTYGNIEGNAAKR
RKQQYKDSLKKRPASAKSRREFDEIELAYRRRPPRSPDHKRYFRDKEGLRDFYLDQFRTK
ENSPHWEHVDLTDIYKERSDDFKRDSVSGGGPCTNRSHLKHGTGEKHGVVGGVPAPWEKN
LTNVDWEDRSGGNFCRSCPSKLHNYSSTVAGQNSGRQACIRCEACKKAGNLYDISKDNSL
QELDQPAAPVAVTSNASSTKYPQSPTNSKAQKKNRNKLRRQHSYDTFVDLQKEEAALAPR
SVSLKDKGRFMDGSPYAHMFEMPAGESSFANKSSVPTAGHHHNNPGSGYMLSKSLYPDRV
TQNPFIPTFGDDQCLLHGSKSYFFRQPTVAGASKTRPDFRALVTNKPVVSALHGAVPGRF
QKDICIGNQSNPCVPNNKNPRAFNGSSNGHVYEKLSSIESDV
NT seq 4449 nt   +upstreamnt  +downstreamnt
atgaagcccagcgcagagtgctgttcccccaagttctggttggtgttggccgtcttggcc
gtatcaggcagcaaagctcgttcccaaaagagcccccccagcatcggcatcgctgtcatc
ctcgtgggcacttcagacgaagtggccataaaagacgcccacgagaaagatgacttccat
catctctcagtagttccccgggtggagctggtagccatgaacgaaactgacccaaagagc
atcatcacccgtatctgcgatcttatgtctgaccggaagatccagggggtggtgttcgcg
gatgacaccgaccaagaagccatcgctcagatcctcgacttcatttctgctcagactctc
acccccatcctgggcatccatgggggctcatctatgataatggcggataaggatgagtcc
tccatgttcttccagtttggcccgtctatcgaacagcaagcttccgtcatgctcaacatc
atggaagaatatgactggtacatcttttccatcgtcaccacctacttccctggctaccag
gactttgtgaacaagatccgcagtaccatcgagaacagcttcgtgggctgggagctcgag
gaagtcctcctgctagacatgtctctggacgatggcgactctaagattcagaatcagctg
aagaagctccaaagccccatcattctcctttattgcacgaaggaggaagccacctacatt
tttgaagtagctaactcagttgggctgactggctacggctacacgtggattgtgccgagt
ctggtggccggggatacggacacggtgccttcagagttccccacggggcttatctctgtg
tcttatgatgaatgggactatggccttcctgccagagtgagagatggaattgccatcatc
accactgctgcctcggacatgctgtccgaacacagtttcatccctgagcccaagagcagt
tgctacaacacccacgagaagaggatctaccagtctaacatgttgaataggtatctgatc
aatgtcacttttgaagggagaaacctgtccttcagcgaagatggctaccagatgcatccg
aagctggtgataatccttctgaacaaggagaggaagtgggagagggtggggaaatggaag
gacaagtccctgcagatgaagtattatgtgtggcctcggatgtgtcctgagactgaggag
caagaggatgaccatctgagcattgtcaccttggaggaggcgccatttgtcattgtggaa
agcgtggaccctctcagtggaacctgcatgaggaatacagtcccgtgccagaagcgcatc
atctctgagaataaaacagatgaggaaccaggctacatcaaaaaatgctgcaaggggttc
tgtattgacatccttaagaaaatttctaagtctgtgaagttcacctatgacctttacctg
gtgaccaatggcaagcacgggaagaagattaatgggacctggaatggcatgatcggtgag
gtggtcatgaagagggcctacatggcagtgggatcactaactatcaatgaagaacggtca
gaggtggttgacttctctgtacccttcatagaaactggcatcagtgtcatggtatctcgc
agcaatgggactgtgtcaccttctgccttcttagagccattcagcgctgacgtgtgggtg
atgatgtttgtgatgctgctcattgtttctgcggtggctgtctttgtctttgaatacttc
agccctgtgggttacaacaggtgcctagccgatggcagagagccaggaggcccatctttc
accatcggcaaagcaatttggttactctggggtctggtgtttaacaactccgtacctgtg
cagaacccaaaggggaccacctccaagatcatggtgtcagtgtgggccttctttgctgtc
attttcctggccagctacactgccaacttagcagccttcatgatccaagaggagtatgtg
gaccaggtttctggcctgagtgacaagaagttccagagacctaatgacttctcaccccct
ttccgctttgggactgtgcccaatggcagcacagagaggaatatccgtaataactatgca
gaaatgcatgcctacatgggaaagttcaaccaaaggggtgtagatgatgcattgctctcc
ctgaaaacagggaagcttgatgcattcatctatgatgcagctgtgctcaactacatggct
ggaagggacgaaggctgcaaactggtgaccattggcagtggcaaggtctttgcttctacc
ggctatggcattgctatccaaaaggactccgggtggaagcgccaggtggacctggctatc
ctgcagctgtttggagatggggagatggaagaactggaagctctctggctcactggcatt
tgccacaatgagaagaatgaggtgatgagcagccagctggacatcgacaatatggcaggt
gtcttctatatgttgggggcagccatggccctcagcctcatcaccttcatctgtgagcat
ctgttctattggcagttccggcattgcttcatgggtgtctgttctggcaagcctggcatg
gtcttctccatcagcagaggtatctacagctgtatccatggggtagccatagaggagcgc
caatccgtgatgaactcccccactgccaccatgaacaacacccactccaacatcctacgc
ttgctccgcacggccaagaacatggccaacctgtctggagtaaacggctcccctcagagt
gccctggacttcatccgccgagagtcctccgtctacgacatctctgagcatcgtcgcagc
ttcacgcattcagactgcaagtcttacaataacccaccctgtgaggaaaacctgttcagt
gactacattagcgaggtagagagaacatttggtaacctgcagctgaaggacagcaatgtg
taccaagaccactatcaccatcaccaccggccacacagcatcggcagcaccagctccatt
gatgggctctatgactgtgacaacccacccttcaccacccagcccaggtcaatcagcaag
aaacccctggacatcggcctgccctcctccaaacatagccagctcagcgacctgtatggc
aagttctctttcaagagtgaccgctacagtggccacgacgacttgattcgatcggatgtc
tccgacatctccacgcacactgtcacctatgggaacatcgagggcaacgcagccaagagg
aggaaacagcagtataaggacagtctaaagaagcggccagcctcggccaaatcgaggagg
gagtttgatgaaatcgagctggcctaccgtcgccgaccaccccgctccccggaccacaag
cgctacttcagggacaaagaagggctccgagacttctacctggaccagttccgaacaaag
gagaactcgcctcactgggagcacgtggacttgactgacatttacaaagaacgcagtgac
gacttcaagcgagattcggtcagtggaggtgggccctgtaccaacaggtctcacctcaaa
cacggaacgggcgagaagcacggagtggtaggcggggtgcctgctccttgggagaagaac
ctgaccaatgtggattgggaggaccggtctgggggcaacttctgccgcagctgtccttcc
aagctgcacaattactcctcgacggtggcagggcagaactcgggccggcaggcctgcatc
agatgtgaggcctgtaagaaggctggtaacctgtacgacatcagcaaggacaactccctg
caggaactggaccagccggctgcccccgtggctgtgacatccaacgcctccagcaccaag
taccctcaaagcccgactaattccaaggctcagaagaagaatcggaacaaactgcgccgg
cagcattcctacgacaccttcgtggacctgcagaaggaggaggccgccttggccccacgc
agcgtgagcctgaaagacaagggccgattcatggatgggagcccctacgcccatatgttt
gagatgccagctggtgagagctcctttgccaacaagtcctcagtgcccactgccggacac
caccacaacaaccccggcagcggctacatgctcagcaagtcgctctaccctgaccgggtc
acgcaaaaccctttcatccccacttttggggatgaccagtgcttgcttcacggcagcaaa
tcctacttcttcaggcagcccacggtggcaggggcgtcaaaaacaaggccggacttccgg
gcccttgtcaccaataagccagtggtgtcagcccttcatggggctgtgccaggtcgtttc
cagaaggacatttgtatagggaaccagtccaacccctgtgtgcctaacaacaaaaacccc
agggctttcaatggctccagcaatggacatgtttatgagaaactttctagtattgagtct
gatgtctga

KEGG   Rattus norvegicus (rat): 24411
Entry
24411             CDS       T01003                                 

Gene name
Grin2c
Definition
(RefSeq) glutamate receptor ionotropic, NMDA 2C
  KO
K05211  glutamate receptor ionotropic, NMDA 2C
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04713  Circadian entrainment
rno04720  Long-term potentiation
rno04724  Glutamatergic synapse
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05033  Nicotine addiction
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    24411 (Grin2c)
   04024 cAMP signaling pathway
    24411 (Grin2c)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24411 (Grin2c)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    24411 (Grin2c)
   04720 Long-term potentiation
    24411 (Grin2c)
  09159 Environmental adaptation
   04713 Circadian entrainment
    24411 (Grin2c)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    24411 (Grin2c)
   05014 Amyotrophic lateral sclerosis
    24411 (Grin2c)
   05017 Spinocerebellar ataxia
    24411 (Grin2c)
   05020 Prion disease
    24411 (Grin2c)
   05022 Pathways of neurodegeneration - multiple diseases
    24411 (Grin2c)
  09165 Substance dependence
   05030 Cocaine addiction
    24411 (Grin2c)
   05031 Amphetamine addiction
    24411 (Grin2c)
   05033 Nicotine addiction
    24411 (Grin2c)
   05034 Alcoholism
    24411 (Grin2c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    24411 (Grin2c)
Ion channels [BR:rno04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   24411 (Grin2c)
SSDB
Motif
Pfam: Lig_chan Lig_chan-Glu_bd SBP_bac_3 ANF_receptor NMDAR2_C
Other DBs
NCBI-GeneID: 24411
NCBI-ProteinID: NP_036707
RGD: 2739
Ensembl: ENSRNOG00000003280
UniProt: Q00961 A0A0G2JSH8
Position
10
AA seq 1250 aa
MPALVSLQDPPVDMGGALGPALLLTSLLGAWARLGAGQGEQAVTVAVVFGSSGPLQTQAR
TRLTSQNFLDLPLEIQPLTVGVNNTNPSSILTQICGLLGAARVHGIVFEDNVDTEAVAQL
LDFVSSQTHVPILSISGGSAVVLTPKEPGSAFLQLGVSLEQQLQVLFKVLEEYDWSAFAV
ITSLHPGHALFLEGVRAVADASYLSWRLLDVLTLELGPGGPRARTQRLLRQVDAPVLVAY
CSREEAEVLFAEAAQAGLVGPGHVWLVPNLALGSTDAPPAAFPVGLISVVTESWRLSLRQ
KVRDGVAILALGAHSYRRQYGTLPAPAGDCRSHPGPVSPAREAFYRHLLNVTWEGRDFSF
SPGGYLVRPTMVVIALNRHRLWEMVGRWDHGVLYMKYPVWPRYSTSLQPVVDSRHLTVAT
LEERPFVIVESPDPGTGGCVPNTVPCRRQSNHTFSSGDLTPYTKLCCKGFCIDILKKLAK
VVKFSYDLYLVTNGKHGKRVRGVWNGMIGEVYYKRADMAIGSLTINEERSEIIDFSVPFV
ETGISVMVSRSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAITVFMFEYFSPVSYNQNLT
KGKKPGGPSFTIGKSVWLLWALVFNNSVPIENPRGTTSKIMVLVWAFFAVIFLASYTANL
AAFMIQEQYIDTVSGLSDKKFQRPQDQYPPFRFGTVPNGSTERNIRSNYRDMHTHMVKFN
QRSVEDALTSLKMGKLDAFIYDAAVLNYMAGKDEGCKLVTIGSGKVFATTGYGIAMQKDS
HWKRAIDLALLQLLGDGETQKLETVWLSGICQNEKNEVMSSKLDIDNMAGVFYMLLVAMG
LALLVFAWEHLVYWKLRHSVPNSSQLDFLLAFSRGIYSCFNGVQSLPSPARPPSPDLTAD
SAQANVLKMLQAARDMVNTADVSSSLDRATRTIENWGNNRRVPAPTASGPRSSTPGPPGQ
PSPSGWGPPGGGRTPLARRAPQPPARPATCGPPLPDVSRPSCRHASDARWPVRVGHQGPH
VSASERRALPERSLLPAHCHYSSFPRAERSGRPYLPLFPEPPEPDDLPLLGPEQLARREA
MLRAAWARGPRPRHASLPSSVAEAFTRSNPLPARCTGHACACPCPQSRPSCRHLAQAQSL
RLPSYPEACVEGVPAGVATWQPRQHVCLHAHTRLPFCWGTVCRHPPPCTSHSPWLIGTWE
PPAHRVRTLGLGTGYRDSGVLEEVSREACGTQGFPRSCTWRRVSSLESEV
NT seq 3753 nt   +upstreamnt  +downstreamnt
atgcctgctctggtttctctgcaggaccctccagtggacatgggtggggccctagggccc
gccctgctgctcacttcactccttggtgcttgggcaaggctgggcgcagggcagggagaa
caggccgtgactgtggcggtggtgtttggcagctctgggccactgcagacccaggcccgg
actcgtcttacctcccagaacttcctggacctgcctctggagatccagccactcaccgta
ggggtcaacaataccaatcccagcagcatcctcacccaaatctgcgggcttctgggtgcc
gcccgtgtccacggcatcgtctttgaggacaacgtggacaccgaggccgtggcccagcta
ctggacttcgtctcctcccagacccacgtgcccatcctcagcatcagcggaggctctgct
gtggtcctcacccccaaggagccaggctccgccttcctacagctgggcgtgtccctggag
cagcagctgcaggtgctgttcaaggtgctggaggaatacgactggagcgcgttcgcggtc
atcaccagcctgcatccgggccacgcgctcttcctcgaaggcgtgcgcgccgtcgcggac
gccagctacctgagctggcggctgctggacgtgctcacgctggagctaggtccgggtggg
ccgcgagcgcgcactcagcgcctgctacgccaggtcgacgcgccggtgctggtggcttac
tgctcccgtgaagaggccgaggtgctcttcgctgaggctgcacaggctggcctggtggga
cccgggcacgtgtggttggtacctaacctggcgctgggaagcaccgacgcaccccctgca
gctttcccggtgggcctcatcagtgtggtcaccgagagttggcgccttagtctacgccag
aaggttcgcgacggagtggccattctggccctcggtgcccacagctaccgacgccagtac
ggtaccctgccagccccggctggggactgccgaagccacccgggacccgtcagccctgct
agggaggccttctacaggcatctgctgaatgtcacctgggagggccgagacttctctttc
agccctggtgggtacctggttcggcccaccatggttgtgatcgccctcaaccggcaccgc
ctctgggagatggtgggacggtgggaccatggagtcctgtacatgaagtatccagtatgg
cctcgctacagcacttctctgcagcctgtggtggacagccggcacctgacagtggccaca
ctggaagaaaggccctttgtcattgtggagagccctgaccctggcacaggtggctgtgtt
cccaacaccgtgccctgccgcagacagagcaaccacaccttcagcagcggggatctaacc
ccctacaccaagctctgttgtaagggcttctgcatcgacatcctcaaaaagctggccaag
gtggtcaagttctcctacgacttgtacctggtgaccaacggcaaacacggcaagagggtt
cgtggtgtgtggaacggcatgatcggggaggtatactacaagcgggcagacatggccatc
ggctccctcaccatcaatgaggagcgctctgagattatagatttctctgtgccttttgtg
gagaccggcatcagtgttatggtatcaaggagcaacggcaccgtctccccctcagctttt
ctggaaccctacagccctgccgtgtgggtgatgatgttcgtgatgtgtctcacggtggtt
gccatcactgtcttcatgttcgagtacttcagccctgtcagctacaaccagaacctcacc
aagggcaagaaacctggtggaccatctttcaccattggcaagtccgtgtggttgctgtgg
gcactggtcttcaacaactctgttcccatcgagaacccccggggtaccaccagcaagatc
atggtcctggtgtgggccttcttcgctgtcatcttcctcgctagctatacggccaatctg
gcggccttcatgatccaggagcaatacatcgacactgtgtcgggccttagtgacaagaag
tttcagcggcctcaagaccaatacccacccttccgttttggcacggtacctaacggcagc
acagagaggaacatccgtagcaactaccgtgacatgcacacccacatggtcaagttcaac
cagcgctcggtggaggacgctctcacaagcctgaagatggggaagctggacgccttcatc
tatgatgctgctgtgctcaactacatggcgggcaaggacgaaggctgcaagctggtcacc
attgggtctggcaaagtctttgccaccactggctatggcattgccatgcagaaagactcc
cactggaagcgggccatagacctggcactcctgcaacttctgggggatggagagacgcag
aagctggagacagtgtggctctcagggatctgccagaacgagaagaatgaggtgatgagc
agcaagctggacattgacaacatggcgggggtcttctacatgctgttggtggccatggga
ctggcccttctggtctttgcctgggagcacctggtctactggaaacttcgacactcggtg
cccaactcatcccagctggacttcctgctggctttcagcaggggcatctacagctgcttc
aacggggtacagagccttccgagtcccgcacggccgcccagcccggatctcaccgcagac
tcagcccaggccaatgtgctgaagatgctgcaggcggcccgagacatggtgaacaccgcg
gacgtgagcagctctttggaccgcgccactcgcaccatcgagaactggggcaacaaccgc
cgcgtgcctgctcccaccgcctctggcccgcggtcctccaccccgggtcctccgggacaa
ccgagccccagcggctgggggcctcctggtgggggccgcaccccgctagcgcgcagggcc
ccgcagcctccggctcgccccgcgacgtgcgggccacctttgcccgatgtgtcccgacca
tcctgcaggcacgcttcggacgcgcggtggccggtgcgagttgggcatcagggaccgcac
gtctcggcttccgagcggcgcgcgctcccggagcgctctctgttgcccgcgcactgccac
tacagttccttccctcgagcggagagatccgggcgcccctacctcccgttattcccggag
cccccggagcccgacgacctgcctctgctcgggccggaacagctggctcggcgggaagca
atgctgcgcgcggcctgggcccggggcccgcgccctcgccacgcttccttgcccagctcg
gtggcagaagctttcactcgatccaaccctctgcctgccaggtgtaccggtcacgcctgt
gcctgcccgtgcccccaaagccggccatcctgcaggcacttggctcaggcacagtcgctg
aggctgccgtcctacccggaggcctgtgtggagggcgtaccagcaggggtggccacctgg
cagcccagacagcacgtctgcctgcacgcccatacccgcctgccgttctgttggggaact
gtctgccgtcaccctccaccctgtaccagccacagcccctggctcattggaacctgggag
cctccagcacacagagtcaggaccctggggctaggcacaggctacagggacagtggggtg
ctggaagaggtcagcagggaagcctgtgggacacaaggttttccaaggtcctgcacctgg
aggcgggtctccagcctggaatcagaagtgtga

KEGG   Rattus norvegicus (rat): 24412
Entry
24412             CDS       T01003                                 

Gene name
Grin2d
Definition
(RefSeq) glutamate receptor ionotropic, NMDA 2D precursor
  KO
K05212  glutamate receptor ionotropic, NMDA 2D
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04713  Circadian entrainment
rno04720  Long-term potentiation
rno04724  Glutamatergic synapse
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis
rno05017  Spinocerebellar ataxia
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05033  Nicotine addiction
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    24412 (Grin2d)
   04024 cAMP signaling pathway
    24412 (Grin2d)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24412 (Grin2d)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    24412 (Grin2d)
   04720 Long-term potentiation
    24412 (Grin2d)
  09159 Environmental adaptation
   04713 Circadian entrainment
    24412 (Grin2d)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    24412 (Grin2d)
   05014 Amyotrophic lateral sclerosis
    24412 (Grin2d)
   05017 Spinocerebellar ataxia
    24412 (Grin2d)
   05020 Prion disease
    24412 (Grin2d)
   05022 Pathways of neurodegeneration - multiple diseases
    24412 (Grin2d)
  09165 Substance dependence
   05030 Cocaine addiction
    24412 (Grin2d)
   05031 Amphetamine addiction
    24412 (Grin2d)
   05033 Nicotine addiction
    24412 (Grin2d)
   05034 Alcoholism
    24412 (Grin2d)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    24412 (Grin2d)
Ion channels [BR:rno04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   24412 (Grin2d)
SSDB
Motif
Pfam: Lig_chan Lig_chan-Glu_bd SBP_bac_3 ANF_receptor NMDAR2_C MatE
Other DBs
NCBI-GeneID: 24412
NCBI-ProteinID: NP_073634
RGD: 2740
Ensembl: ENSRNOG00000021063
UniProt: Q62645
Structure
PDB: 
3OEN 3OEK 3OEL 3OEM 4JWY

Position
1
AA seq 1323 aa
MRGAGGPRGPRGPAKMLLLLALACASPFPEEVPGPGAVGGGTGGARPLNVALVFSGPAYA
AEAARLGPAVAAAVRSPGLDVRPVALVLNGSDPRSLVLQLCDLLSGLRVHGVVFEDDSRA
PAVAPILDFLSAQTSLPIVAVHGGAALVLTPKEKGSTFLQLGSSTEQQLQVIFEVLEEYD
WTSFVAVTTRAPGHRAFLSYIEVLTDGSLVGWEHRGALTLDPGAGEAVLGAQLRSVSAQI
RLLFCAREEAEPVFRAAEEAGLTGPGYVWFMVGPQLAGGGGSGVPGEPLLLPGGSPLPAG
LFAVRSAGWRDDLARRVAAGVAVVARGAQALLRDYGFLPELGHDCRTQNRTHRGESLHRY
FMNITWDNRDYSFNEDGFLVNPSLVVISLTRDRTWEVVGSWEQQTLRLKYPLWSRYGRFL
QPVDDTQHLTVATLEERPFVIVEPADPISGTCIRDSVPCRSQLNRTHSPPPDAPRPEKRC
CKGFCIDILKRLAHTIGFSYDLYLVTNGKHGKKIDGVWNGMIGEVFYQRADMAIGSLTIN
EERSEIVDFSVPFVETGISVMVARSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAVTVFI
FEYLSPVGYNRSLATGKRPGGSTFTIGKSIWLLWALVFNNSVPVENPRGTTSKIMVLVWA
FFAVIFLASYTANLAAFMIQEEYVDTVSGLSDRKFQRPQEQYPPLKFGTVPNGSTEKNIR
SNYPDMHSYMVRYNQPRVEEALTQLKAGKLDAFIYDAAVLNYMARKDEGCKLVTIGSGKV
FATTGYGIALHKGSRWKRPIDLALLQFLGDDEIEMLERLWLSGICHNDKIEVMSSKLDID
NMAGVFYMLLVAMGLSLLVFAWEHLVYWRLRHCLGPTHRMDFLLAFSRGMYSCCSAEAAP
PPAKPPPPPQPLPSPAYPAARPPPGPAPFVPRERAAADRWRRAKGTGPPGGAAIADGFHR
YYGPIEPQGLGLGEARAAPRGAAGRPLSPPTTQPPQKPPPSYFAIVREQEPTEPPAGAFP
GFPSPPAPPAAAAAAVGPPLCRLAFEDESPPAPSRWPRSDPESQPLLGGGAGGPSAGAPT
APPPRRAAPPPCAYLDLEPSPSDSEDSESLGGASLGGLEPWWFADFPYPYAERLGPPPGR
YWSVDKLGGWRAGSWDYLPPRGGPAWHCRHCASLELLPPPRHLSCSHDGLDGGWWAPPPP
PWAAGPPPRRRARCGCPRPHPHRPRASHRAPAAAPHHHRHRRAAGGWDFPPPAPTSRSLE
DLSSCPRAAPTRRLTGPSRHARRCPHAAHWGPPLPTASHRRHRGGDLGTRRGSAHFSSLE
SEV
NT seq 3972 nt   +upstreamnt  +downstreamnt
atgcgcggcgccggtggcccccgcggccctcggggccccgctaagatgctgctgctgctg
gcgctggcgtgcgccagcccgttcccggaggaggtgccggggccgggcgcggtcggcggg
ggcacgggcggggcgcggccactcaacgtggcgcttgtcttctccggcccggcatatgcg
gcagaggcggcgcgcttgggcccggccgtggcagcggcagtgcgcagccccggcctggac
gtacggcccgtggcgctggtgctcaacggctccgaccctcgcagccttgtgctgcagctc
tgcgacctgctgtcggggctgcgcgtgcacggcgtggtgttcgaggacgactcgcgcgcg
cccgccgtcgcgcccattctcgacttcctgtccgcgcagacctcgctgcccatcgtagcc
gtgcacggcggcgccgcgctcgtgctcacacccaaggagaagggctccaccttcctgcag
cttggctcctccacagagcaacagttgcaggtcatttttgaggtgctggaggagtacgac
tggacatcctttgtggcagtgaccacgcgtgccccaggccatcgggccttcttgtcatac
atcgaggtgctgactgatggcagcctggtgggctgggagcatcgaggagcgctgacactg
gaccccggggcgggtgaggctgtactgggcgcacagctccgtagtgtcagtgcgcagatc
cgcctgctcttctgcgcccgcgaggaggcagagcctgttttccgggcagcggaagaggcc
ggcctcactgggcctggctacgtctggttcatggtgggaccccagctggctggaggcggg
ggctccggggtccctggggagccccttcttctgccaggaggttccccactgcctgccggg
ctgtttgcagtgcgctctgctggctggcgtgacgacttggcacgtcgagtggctgctggt
gtggcggtggtggccagaggtgcccaggccctgctgcgagactatggcttcctgcctgag
ctgggtcatgactgccgcacccagaatcgcacccaccgcggggagagtctgcacaggtac
ttcatgaacatcacctgggataaccgagactactccttcaatgaggatggctttctggtg
aacccttcactggtggtcatctccctcaccagagacaggacatgggaagtggtgggcagc
tgggaacagcagaccctccgcctcaagtaccctctatggtcccgctatggccgcttcctg
cagccagtggatgacacacagcacctcactgtggccacgctggaggagagaccctttgtc
attgtagagcctgcagaccccatcagcggcacttgcatcagagactcggtcccctgccgg
agccagctcaaccgtacccacagccctccgcctgacgctccccgcccggagaagagatgc
tgcaagggtttctgcattgatattctgaagaggctggcgcacaccatcggtttcagctat
gacctctacctggttaccaacggcaagcatggcaagaagatcgatggcgtctggaatggc
atgattggtgaggtgttctatcagcgtgcggacatggccatcggctctctcaccatcaat
gaggagcggtcagagatcgtggacttctccgtcccctttgtagagacaggcatcagcgtc
atggtggcacgcagcaatggcactgtgtccccctctgccttcctcgagccctacagccct
gctgtctgggtgatgatgttcgtcatgtgcctcaccgtggtcgccgtcacagttttcatc
tttgagtacctcagtcctgtgggctataaccgaagcctggccacgggcaaacgccctggt
ggctctaccttcaccattgggaaatccatctggctgctgtgggccctggtcttcaacaac
tccgtgccagtggagaatcctcggggcaccaccagcaagatcatggtgctggtgtgggcc
ttcttcgcggtcatctttcttgccagctacacagccaatctggccgccttcatgatccag
gaggagtacgtggacaccgtgtctgggctcagcgaccggaagttccagcgaccccaggag
caatacccacctctgaagtttggcacggtgcccaatgggtccacggaaaagaacatccgg
agcaactaccctgacatgcacagctacatggtgcgatacaaccagccgagagtggaggag
gcactcacacagctcaaggcagggaaactggacgccttcatctatgacgcagcagtgctc
aactacatggcccgcaaggatgagggctgcaagctggtcaccatcggctccggcaaggtc
ttcgccaccactggttatggcatcgccctacacaagggctcccgctggaagaggcccatc
gacctggcgctgctgcagttcctgggggacgatgagattgagatgctggagcggctgtgg
ctttcagggatctgccacaatgacaaaatcgaagtgatgagtagcaagctggatatcgac
aacatggcaggtgtcttctacatgctccttgtggccatgggcctctccttgctggtcttc
gcctgggaacatctggtgtactggcgcctgcggcattgcctgggtcccacccaccgcatg
gatttcctactggccttctccaggggtatgtacagctgctgcagcgccgaggctgctcca
ccgccggccaagcctccgccaccgcctcagccgctgcccagtcccgcatatcccgccgct
cgcccgccccctggccccgcacccttcgtgccccgagagcgcgcagctgccgaccgctgg
cgccgagccaagggcacagggcccccggggggcgcagcgatagccgacggcttccaccga
tactacggccccatcgagccacaggggctgggcctcggcgaggcacgcgcggcaccgaga
ggcgcagccggacgcccactgtccccacccaccacacagcccccgcagaagccaccacct
tcctacttcgccatcgtgcgcgagcaggagccgaccgagcccccggccggcgccttcccc
ggcttcccatctccgcctgcgccgcccgctgcggctgccgctgccgtcgggccgccactg
tgtcgcctggctttcgaggacgaaagcccgcccgcaccctcgcgctggccgcgttcagat
cccgagagccagcctctgttgggtgggggcgcgggcggcccgagcgcgggggccccaacc
gcaccaccgccgcgccgtgccgcgccaccaccgtgcgcctacctggacctcgagccttcg
ccttcggactccgaggactcggagagcctgggcggagcatcgctcggtggcctggagccc
tggtggttcgccgacttcccctacccgtatgccgagcgcctcgggccgccgcccggccgc
tactggtcggtcgacaagctcgggggctggcgcgctggtagctgggactacctgcccccg
cgcggaggccccgcgtggcactgccgccactgcgccagcctggagctgctaccgccaccg
cgccacctcagctgctcgcacgacggcttagacggcggctggtgggcgcctccgcctcca
ccctgggccgcggggccacctccccggcgccgggcgcgctgtggttgtccgcgacctcac
ccacaccgcccccgggcctcgcaccgtgcgcccgccgccgcgccgcaccaccaccgacac
aggcgcgcggccggtggctgggacttcccgccgcccgcgcccacctcgcgttcgctggag
gacctgagctcctgcccgcgggcggcccccacgcgcaggctcaccgggccatcccgccac
gcgcgccgctgcccgcacgctgcgcactgggggccgcccctgcccaccgcatcgcaccgg
agacaccggggcggggacctgggcacacgcaggggctctgcgcatttctccagcctggag
tccgaggtatga

DBGET integrated database retrieval system