KEGG   Rattus norvegicus (rat): 24511
Entry
24511             CDS       T01003                                 

Gene name
Itgb1
Definition
(RefSeq) integrin beta-1 precursor
  KO
K05719  integrin beta 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04145  Phagosome
rno04151  PI3K-Akt signaling pathway
rno04360  Axon guidance
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04514  Cell adhesion molecules
rno04530  Tight junction
rno04611  Platelet activation
rno04670  Leukocyte transendothelial migration
rno04810  Regulation of actin cytoskeleton
rno05100  Bacterial invasion of epithelial cells
rno05133  Pertussis
rno05135  Yersinia infection
rno05140  Leishmaniasis
rno05145  Toxoplasmosis
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05222  Small cell lung cancer
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    24511 (Itgb1)
   04151 PI3K-Akt signaling pathway
    24511 (Itgb1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    24511 (Itgb1)
   04514 Cell adhesion molecules
    24511 (Itgb1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    24511 (Itgb1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    24511 (Itgb1)
   04530 Tight junction
    24511 (Itgb1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    24511 (Itgb1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    24511 (Itgb1)
   04670 Leukocyte transendothelial migration
    24511 (Itgb1)
  09158 Development and regeneration
   04360 Axon guidance
    24511 (Itgb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24511 (Itgb1)
   05205 Proteoglycans in cancer
    24511 (Itgb1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    24511 (Itgb1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    24511 (Itgb1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    24511 (Itgb1)
   05133 Pertussis
    24511 (Itgb1)
   05100 Bacterial invasion of epithelial cells
    24511 (Itgb1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    24511 (Itgb1)
   05140 Leishmaniasis
    24511 (Itgb1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    24511 (Itgb1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    24511 (Itgb1)
   05414 Dilated cardiomyopathy
    24511 (Itgb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    24511 (Itgb1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24511 (Itgb1)
   04515 Cell adhesion molecules [BR:rno04515]
    24511 (Itgb1)
   04090 CD molecules [BR:rno04090]
    24511 (Itgb1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    24511 (Itgb1)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   24511 (Itgb1)
Cell adhesion molecules [BR:rno04515]
 Integrins
  Integrin beta subunits
   24511 (Itgb1)
CD molecules [BR:rno04090]
 Proteins
  24511 (Itgb1)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail I-EGF_1 PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 24511
NCBI-ProteinID: NP_058718
RGD: 2927
Ensembl: ENSRNOG00000010966
UniProt: P49134 A0A0G2JSK5
Position
19
AA seq 798 aa
MNLQLVFWIGLISLICSVFGQTDKNRCLKANAKSCGECIQAGPNCGWCTNTTFLQEGMPT
SARCDDLEALKKKGCQPSDIENPRGSQTIKKNKNVTNRSKGMAEKLRPEDITQIQPQQLL
LKLRSGEPQKFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTDRGEFFNELVGQQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENNVYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SGNSSNVIQLIIDAYNSLSSEVILENSKLPDGVTINYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISITANKCPNKESETIKIKPLGFTEEVEVVLQFICKCNCQSHGIPASPKCHEG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
RENTNEIYSGKFCECDNFNCDRSNGLICGGNGVCRCRVCECYPNYTGSACDCSLDTVPCV
ATNGQICNGRGICECGACKCTDPKFQGPTCETCQTCLGVCAEHKECVQCRAFNKGEKKDT
CAQECSHFNLTKVESREKLPQPVQVDPVTHCKEKDIDDCWFYFTYSVNSNGEAHVHVVET
PDCPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGEN
PIYKSAVTTVVNPKYEGK
NT seq 2397 nt   +upstreamnt  +downstreamnt
atgaatttgcaactggttttctggattggattgatcagcttgatttgttctgtatttggc
caaacagataaaaatagatgtttaaaagcaaatgccaaatcttgtggagaatgtatacaa
gcagggccaaattgtgggtggtgtacaaatacgacatttttacaagaaggaatgcctact
tctgcacgatgtgatgatttagaagctttgaaaaagaagggttgccaaccaagtgacata
gagaatcccagaggctcccaaactataaagaagaataaaaacgtcaccaatcgcagcaaa
gggatggcagagaagctccggccagaagacattactcagatccaaccacaacagctgctt
ctaaagttgcgatcaggagaaccacagaagtttacattaaaattcaagagggctgaagac
taccctattgatctgtactaccttatggatctctcctactctatgaaagatgatctggag
aatgtgaagagtcttgggacggatctgatgaatgaaatgaggaggattacttcagacttc
cgcattggctttggctcatttgtggagaaaactgtgatgccatacattagtacaacacca
gcaaagctaagaaatccttgtacgagtgaacaaaactgtaccagcccatttagctacaaa
aacgtgcttagtcttactgacagaggagagtttttcaatgaacttgttggtcagcagcgc
atatctggaaacttggactctccagaaggtggctttgatgcaatcatgcaggttgcagtt
tgtgggtcgctgattggctggaggaatgtaacacgactgctggtgttttccacggatgct
gggtttcactttgctggagatgggaaacttggtggtattgttttacccaatgatggccag
tgtcacctggaaaataatgtgtatacaatgagccattactatgattatccttcaattgct
caccttgttcagaaactaagtgaaaataatattcagacgatttttgcagtcactgaagag
ttccagcctgtttacaaggaattgaagaatttgattcctaagtcagcagtgggcacactg
tctggaaactctagtaatgtgatacagctgattatcgatgcctacaattccctttcttca
gaagtcattctggaaaacagcaaattgccagatggagtaacaataaattacaagtcctac
tgcaagaatggagtgaatgggacaggagaaaatggacgaaagtgctctaacatttccatt
ggagatgaggttcaatttgaaattagcataactgctaataaatgtccaaacaaggagtct
gaaacaattaaaattaaacctctgggcttcacagaagaagtagaggtggtccttcagttc
atctgtaagtgtaattgtcaaagccatggcatcccagcaagtcccaagtgccatgaggga
aatgggacatttgagtgtggagcctgcaggtgcaatgagggtcgtgttgggagacactgt
gaatgtagcacagatgaagtgaacagtgaagacatggatgcttactgcagaaaagagaac
agctcagagatctgcagtaacaatggagagtgtgtctgtggacagtgtgtgtgcaggaag
agagagaatacaaatgaaatttactccggcaaattctgcgagtgtgataacttcaactgc
gataggtccaacggcttaatctgtggaggaaatggtgtgtgcaggtgtcgtgtctgtgaa
tgctatcccaactacactggcagtgcatgtgactgttccttggacactgttccatgcgta
gcgacaaatggtcagatctgcaatggccggggcatctgtgaatgtggtgcttgtaagtgc
acagatcccaagttccaagggccaacctgtgagacctgtcagacctgccttggtgtctgt
gcagagcataaagaatgtgttcagtgcagagccttcaataaaggagaaaaaaaagacacg
tgtgcacaggagtgctcccatttcaacctcactaaagtggaaagcagggagaagttgccc
cagcctgtgcaggtggaccctgtgacccactgcaaggagaaggacattgatgactgctgg
ttctatttcacctactcagtgaacagcaacggtgaagctcacgtgcatgttgtggagact
ccagactgtcctactggtcccgacatcatcccaattgtagcaggcgtggttgccggaatt
gttcttattggccttgccttgctgctgatttggaaacttttaatgataattcatgacaga
agggaatttgctaaatttgaaaaggagaaaatgaatgccaagtgggacacgggtgaaaat
cctatttacaagagtgccgtgacaactgtggtcaatccgaagtatgagggaaaatga

KEGG   Rattus norvegicus (rat): 25713
Entry
25713             CDS       T01003                                 

Gene name
Itgb7
Definition
(RefSeq) integrin beta-7 precursor
  KO
K06590  integrin beta 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04514  Cell adhesion molecules
rno04672  Intestinal immune network for IgA production
rno04810  Regulation of actin cytoskeleton
rno05165  Human papillomavirus infection
rno05202  Transcriptional misregulation in cancer
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    25713 (Itgb7)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    25713 (Itgb7)
   04514 Cell adhesion molecules
    25713 (Itgb7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    25713 (Itgb7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    25713 (Itgb7)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    25713 (Itgb7)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    25713 (Itgb7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    25713 (Itgb7)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    25713 (Itgb7)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    25713 (Itgb7)
   05414 Dilated cardiomyopathy
    25713 (Itgb7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25713 (Itgb7)
   04515 Cell adhesion molecules [BR:rno04515]
    25713 (Itgb7)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   25713 (Itgb7)
Cell adhesion molecules [BR:rno04515]
 Integrins
  Integrin beta subunits
   25713 (Itgb7)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt PSI_integrin I-EGF_1 EGF_2
Other DBs
NCBI-GeneID: 25713
NCBI-ProteinID: NP_037303
RGD: 2929
Ensembl: ENSRNOG00000012208
UniProt: G3V7M2
Position
7
AA seq 807 aa
MVDSSTVLIFLLVLGGGQSELDTKITSSGETTEWEDPDLSPQGSCQPAPSCQKCILSHPS
CAWCKQLNFTASGEAEARRCARREELLARGCPEQELEEPRGHQEVLQDRPLSQGDRGEGA
TQLAPQRIRVTLRPGEPQKFRVRFLRAAGYPVDLYYLMDLSYSMKDDLERVRQLGQALLL
RLREVTHSVRIGFGSFVDKTVLPFVSTVPSKLNHPCPSRLERCQAPFSYHHVLPLTRDAQ
AFEREVGRQNVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFMPSDGRCHLDSNGVYTNSAEFDYPSVGQVAQALTAANIQPIFAVTGATLPVYQELS
QLIPKSAVGELSEDSSNVVQLIMDAYDNLSSTVTLEHSSLPPGVSISFESHCRSPEKSEG
EAGDRRGQCNHVRVNQMVDFWVTLQASHCLPEAHVLRLWALGFSEELTVELHTLCDCNCS
DAQPRAPYCSDGQGDLQCGICSCAPGRLGQLCECSEADLSSPDLESGCRAPNGTGPLCSG
KGRCQCGRCSCSGQSSGRLCECDDASCERHEGILCGGFGHCQCGVCHCHANRTGRACECS
ESVDSCVSPEGGLCSGHGDCKCNRCQCLDGYYGALCDQCLGCKSPCEQYRDCAECGAFGT
GPLAANCSAACADVNVTLALAPNLDDGWCKERTLDNQLFFFLVENSARGVILRVRPQEKG
ADHTRAIILGCVGGIVAVGLGLVLAYRLSVEVYDRLEYSRFEKERQQLNWKQDSNPLYKS
AVTTTVNPRFQGGNKQSLSLPLTQEAD
NT seq 2424 nt   +upstreamnt  +downstreamnt
atggtggattcatcaactgttctcatttttctgctcgttctgggcggaggtcagagtgag
ttagataccaagattacgtcctcaggggagaccacagaatgggaggatcctgacctgtct
ccacagggatcctgccagccagctccttcctgccagaagtgtatactctcacaccccagc
tgtgcatggtgcaagcaactgaacttcactgcctcgggggaggcagaggcgaggcgctgc
gcgcggcgtgaggagctactggcccgcgggtgccccgagcaggagctggaggagccgaga
ggccaccaggaggtgctgcaggacaggccactcagccagggagaccgcggcgagggggcc
acccagctggccccgcagcggatccgcgtcacgttgcgaccaggggagccccagaaattc
cgggtccgcttcctccgagctgcgggatatcccgtggacctgtactaccttatggacctg
agctattcaatgaaggacgacttggaacgtgtgcgacagctcgggcaagccctgctgctc
cggctgcgggaggtcacccattctgtgcgcataggttttggctcctttgtggacaaaacg
gtgctaccctttgtaagcacagtgccctccaagcttaaccacccatgccccagccggttg
gagcgctgtcaggcacccttcagctatcaccacgtgttgcccctcaccagggatgctcaa
gccttcgagagagaggtgggacgccagaacgtctctggcaacctggactcacccgaagga
ggctttgatgccattttgcaggctgctctttgccaggagcagattggctggagaaatgtg
tcccggcttctggtgttcacttcagacgatacgttccacacagctggggatgggaaactg
ggtggcattttcatgcccagcgatgggcggtgccacctggacagcaacggtgtctacact
aacagcgcagagtttgactatccctctgtgggccaagtagcccaggctctcacagcagcg
aatatccaacctatctttgctgtcaccggcgcaacactgcccgtgtatcaggagctgagc
cagttgattcccaagtctgctgtcggggagctcagcgaagactccagcaatgtggtgcag
ctcatcatggatgcttacgacaacctgtcatccaccgtgactcttgaacactcttcgctc
ccacctggagtcagcatctctttcgagtctcactgtaggagtcctgagaagagtgagggt
gaggctggggaccgtcggggacagtgcaatcatgtccgagtcaaccagatggtggatttc
tgggtcactcttcaagcctctcactgcctcccagaagcccatgtcctacggctctgggcc
cttggcttctcagaggagttaactgtggagctgcacacactgtgtgactgcaattgtagt
gatgcccagcctcgcgctccttactgcagcgatggacagggggaccttcaatgcgggata
tgcagctgtgcccctggccgccttggtcagctgtgtgaatgctctgaggctgacctgtcc
tccccagatttggaatctggttgccgggcccccaatgggacagggcccctgtgcagcggg
aagggtcgatgccaatgtggacgctgcagttgcagtggacagagctctgggcgtctgtgc
gagtgtgatgatgccagctgtgagcgacacgagggcatcctctgtggaggctttggccac
tgccagtgtggagtgtgtcactgccatgccaaccgcactggcagagcatgtgagtgcagt
gagagtgtggacagctgcgttagtcccgaaggagggctctgcagtgggcatggtgactgc
aaatgcaaccgttgccagtgcctggatggctactacggggctctgtgtgaccagtgccta
ggctgcaagtcaccatgtgagcaatacagggactgcgcggagtgtggggcgtttggtacg
ggtcccctggcagccaactgcagcgcggcttgtgctgacgtgaatgtgaccttggccttg
gcccccaatttggatgatggttggtgcaaagagaggacgctagacaaccagctgttcttc
ttcctggtggagaattcggccagaggggtcatactgagagtgagaccccaagagaaggga
gcagaccacacccgtgccatcatactgggctgcgtagggggcattgtggcagtgggatta
gggctggtcctggcttaccggctctcagtggaagtctatgaccgccttgagtacagccgc
tttgagaaggagaggcagcaactcaactggaagcaggacagcaatcctctctacaaaagt
gcggtcacaactaccgtcaaccctcgcttccaagggggcaacaaacagtcgctgtccctc
cctctgacccaggaggctgactga

KEGG   Rattus norvegicus (rat): 25724
Entry
25724             CDS       T01003                                 

Gene name
Itgb4
Definition
(RefSeq) integrin beta-4 precursor
  KO
K06525  integrin beta 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04810  Regulation of actin cytoskeleton
rno05165  Human papillomavirus infection
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    25724 (Itgb4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    25724 (Itgb4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    25724 (Itgb4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    25724 (Itgb4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    25724 (Itgb4)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    25724 (Itgb4)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    25724 (Itgb4)
   05414 Dilated cardiomyopathy
    25724 (Itgb4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25724 (Itgb4)
   04515 Cell adhesion molecules [BR:rno04515]
    25724 (Itgb4)
   04090 CD molecules [BR:rno04090]
    25724 (Itgb4)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   25724 (Itgb4)
  Exosomal proteins of bladder cancer cells
   25724 (Itgb4)
Cell adhesion molecules [BR:rno04515]
 Integrins
  Integrin beta subunits
   25724 (Itgb4)
CD molecules [BR:rno04090]
 Proteins
  25724 (Itgb4)
SSDB
Motif
Pfam: Integrin_beta fn3 Calx-beta Integrin_B_tail PSI_integrin I-EGF_1 Pur_ac_phosph_N EGF_2 SEA
Other DBs
NCBI-GeneID: 25724
NCBI-ProteinID: NP_037312
RGD: 2928
Ensembl: ENSRNOG00000005580
UniProt: Q64632
Structure
PDB: 
6HYF

Position
10
AA seq 1807 aa
MAGLCSSPWVKLLLAVVLSAGLPGNMANRCKKAQVKSCTECIRVDKSCAYCTDELFKERR
CNTQAELLAAGCRGESVLVMESSLEITENIQIDTSLHRSQVSPQGLQVRLRPGEERNFVF
KVFEPLESPVDLYILMDFSNSMSDDLDNLKQMGQNLAKILRQLTSDYTIGFGKFVDKVSV
PQTDMRPEKLKEPWPNSDPPFSFKNVISLTENVEEFWDKLQGERISGNLDAPEGGFDAIL
QTAVCTRDIGWRADSTHLLVFSTESAFHYEADGANVLAGIMNRNDEKCHLDATGAYTQYK
TQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYEKLHKYFPVSSLGVLQEDSSNIVELLE
EAFYRIRSNLDIRALDSPRGLRTEVTSDTLQKTETGSFHIKRGEVGTYNVHLRAVEDIDG
THVCQMAKEDQRGNIHLKPSFSDGLRMDASVICDVCACELQKEVQSARCHYRGDFMCGHC
VCNEGWSGKTCNCSTGSLSDTQPCLREGEDKPCSGHGECQCGRCVCYGEGRYEGHFCEYD
NFQCPRTSGFLCNDRGRCSMGECVCEPGWTGRSCDCPLSNATCIDSNGGICNGLGFCECG
RCHCNQRSSLYTDTTCEINYSAIRLGLCEDLRSCVQCQAWGTGEKKGRTCEECNFKVKMV
DELKKAEEVVEYCSFRDEDDDCTYSYTVEGDGSPGPNSTVLVHKKKDCPPGSFWWLIPLL
IFLLLLLVLLLLLCWKYCACCKACLGLLPCCNQGHMVGFKEDHYMLRENLMASDHLDTPM
LRSGNLKGRDTVRWKITNNVQRPGFATHAASISPTELVPYGLSLRLGRLCTENLMKPGTR
ECDQLRQEVEENLNEVYRQVNGVHKLQQTKFRQQPNAGKKQDHTIVDTVLLAPRSAKQSL
LKLTEKQVEQGSFHELKVAPGYYTLTAEQDARGMVEFQEGVELVDVRVPLFIRPEDDDEK
QLLVEAIDVPVGTATLGRRLVNITIIKEQASGIVSFEQPEYSVSRGDQVARIPVIRHILD
NGKSQVSYSTQDNTAHGHRDYVPVEGELLFYPGETWKELQVKLLELQEVDSLLRGRQVRR
FQVQLSNPKFGARLGQPNTATVIIGEQDETDRSLINEISASPPLPRGDLGAPQNPNAKAA
GSRKIHFNWLPPPGKPMGYRVKYWVQGDSESEAHLLDSKVPSVELTNLYPYCDYEMKVCA
YGAHGEGPYSSLVSCRTHQEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYG
LVNEDNRPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLAT
QPKRPMSIPIIPDIPIVDAQGGEDYENFLMYSDDVLRSPASSQRPSVSDDTEHLVNGRMD
FAYPGSANSLHRMTAANVAYGTHLSPHQTHRMLSTSSTLTRDYHSLTRTDHSQSGTLPRD
YSTLTSLSSQGLPPIWEDGRSRLPLSWTLGSWSRAQMKGVPASRGSPDSIILAGQSAAPS
WGTDSRGAMGVPDTPTRLVFSALGPTSLKVSWQEPQCDRALLGYSVEYQLLNGGEMHRLN
IPNPGQTSVVVEDLLPNHSYVFRVRAQSQEGWGREREGVITIESQVHPQSPLCPLPGSAF
TLSTPSAPGPLVFTALSPDSLQLSWERPRRPNGDILGYLVTCEMAQGGGPARTFRVDGDN
PESRLTVPGLSENVPYKFKVQARTTEGFGPEREGIITIESQDGGPFPQLGSHSGLFQNPL
QSEYSTVTSTHSTTTTEPFLIDGLTLGTQRLEAGGSLTRHVTQEFVSRTLTTSGSLSTHM
DQQFFQT
NT seq 5424 nt   +upstreamnt  +downstreamnt
atggcagggctatgttccagcccgtgggtgaagctgctactggcagtagtgctgagtgcc
ggtctccctggaaacatggccaaccgctgtaagaaggctcaggtgaagagctgtacggag
tgcatccgagtggacaagagctgtgcctactgcacagacgagctgttcaaggagcgacgc
tgcaacacccaggcggagcttctggctgcaggctgccggggagagagcgtgttggtcatg
gagagcagccttgagatcacagagaacatccagattgacaccagcctgcaccgcagccag
gtatctccccaaggcctgcaagtgcggctgcggccgggtgaggagcgcaactttgtgttc
aaggtgtttgagcccctggagagccccgtggatctgtatatcctcatggacttttccaac
tccatgtctgatgatctggacaacctcaagcagatggggcagaacctggccaagatcctg
cgccagctcaccagtgactacactattggattcggaaagtttgtggacaaagtcagtgtc
cctcagacggacatgaggcccgagaagctgaaggagccgtggcccaacagcgacccccca
ttctccttcaagaatgttatcagcttaacagagaatgtggaggaattctgggacaaactg
caaggagaacgcatctcaggcaacctggacgctcctgaaggaggcttcgacgccatcctg
cagacagccgtgtgcacaagggacattggctggagagcggacagcacccacctgctggtg
ttctccaccgagtctgccttccactatgaggctgatggtgccaacgtgctggccggcatc
atgaaccgcaatgatgagaagtgccacctggatgccacaggcgcctacacccagtataag
acccaggactacccatctgtgcccacactggttcgcctgcttgccaaacacaacattatc
cccatctttgccgtcaccaactactcttacagttactacgagaagctccataaatatttc
cctgtctcctctctgggagtcctgcaggaagattcatccaacatcgtggagctgctggag
gaggctttctatcgaattcgctccaacctggacatccgggctctggacagcccgagaggc
ctgaggacagaggtcacctccgataccctccagaagacagagactgggtcctttcacatc
aagcggggggaagtgggcacatacaatgtgcatcttcgggcagtggaggacatagatggg
acacacgtgtgccagatggccaaagaagaccaaagaggtaacatccacctgaaaccctcc
ttctccgatggcctccggatggacgcgagcgtcatctgtgacgtgtgcgcctgcgagctg
caaaaggaagttcagtcagctcgctgtcactacagaggagacttcatgtgtggacactgt
gtgtgcaacgagggctggagtggcaaaacctgcaattgctccacgggttccctgagtgac
acgcagccctgcctgcgtgagggtgaggacaaaccatgctcgggccatggcgagtgccag
tgcggacgttgtgtgtgctacggtgaaggccgctacgagggtcacttctgcgagtatgac
aacttccagtgtccccgcacctctggattcctttgcaatgaccggggacgctgctccatg
ggagagtgtgtgtgtgagcctggttggaccggccgcagctgtgactgtcccctcagcaat
gccacctgtatcgatagcaatgggggcatctgcaatggactaggcttctgtgagtgtggc
cgttgtcactgcaaccagcggtcttcgctctacacggacaccacctgtgagatcaactac
tcggcgatacgcctgggcctctgtgaggacctccgctcctgtgtacagtgccaggcctgg
ggcactggggagaagaaagggcgcacgtgtgaggaatgcaactttaaggtcaagatggta
gacgagcttaagaaagcggaagaggtggtggagtactgctccttccgggacgaggatgac
gactgcacttacagctacaccgtggagggcgacggcagccctgggcccaacagcaccgtc
ctggtccacaagaagaaagactgccctcccggctccttctggtggctcattcccctgctc
atcttcctcctgttgctcctggtgttgcttctgctgctctgctggaaatactgtgcctgc
tgcaaagcctgcctgggacttcttccttgctgcaaccaaggtcacatggtgggctttaag
gaagatcactatatgctgcgggagaacctgatggcctctgaccacctggacacgcccatg
ctgagaagtgggaacctcaagggacgagacacagtccgctggaagatcaccaacaatgtg
caacggcctggctttgccacccatgctgccagcatcagccccacagagctcgtaccctat
gggctatccctgcgccttggccgcctctgcactgagaacctcatgaagcctggcacccga
gagtgtgaccagctacgccaggaggtggaggaaaatctgaatgaggtatacagacaagtc
aacggcgtacacaagctccagcagacgaagttccgacagcaacccaacgctgggaaaaag
caagaccacaccattgtggacacagtgttgctggcgccccgctctgccaagcagtcgctg
ctgaagctgacagagaagcaggtggagcaggggtccttccatgaactcaaggtggcccct
ggttactacaccctcacagcagagcaggatgcccggggcatggtggagttccaggagggg
gtagagctggtggacgtgcgtgtgcccctcttcatccggcctgaggatgatgatgagaaa
cagctgctggtggaggccattgatgtccccgtgggcactgccacccttggtcgacgcctg
gtaaacatcaccatcattaaggagcaagctagcgggatagtgtcctttgagcagcctgaa
tactcagtgagtcgtggagaccaggtggcccgcatccctgtcatccggcacatcctggac
aacggcaagtcccaggtctcctatagcacacaggataatacagcacatggacaccgggat
tatgtccctgtggaaggggagctgttgttctaccccggagagacctggaaggaactgcag
gtgaagctcctggagctgcaggaagtcgactccctccttcgtggccgccaggtccgacgc
ttccaagttcaactcagcaaccccaagtttggagcccgcctgggccagcccaacacagcc
actgttatcatcggggaacaagatgaaacggacagaagtctcataaatgagatatccgca
tcgccgccactaccccgtggagacctgggtgccccgcagaaccccaatgccaaggctgcc
ggatccaggaagatccatttcaactggctgccccctcctggcaagccaatggggtatagg
gtgaaatactgggtccagggcgactctgagtccgaagcccacctgctggacagcaaggtg
ccctcagtggagctcaccaacctgtatccctattgcgactacgaaatgaaggtgtgcgcc
tacggggcacacggggaggggccctatagctcactggtgtcctgccgcacccaccaggaa
gtgcccagtgagccaggaaggctggctttcaatgtagtttcttctacggtgacccagctg
agctgggcagaaccagctgaaaccaacggggagatcacagcctatgaggtctgctatgga
ctggtcaacgaggacaaccgacccattggacctatgaagaaggtgcttgtggacaacccc
aagaaccggatgctgctcattgagaatcttcgagagtcccagccataccgatacacggtg
aaggcgcgaaacggggcaggatggggacccgagagagaggctatcatcaacctggccaca
cagcccaagcggcccatgtccattcctatcatcccagacatccccatagtggacgcccag
ggtggagaagactacgaaaacttcctcatgtacagtgacgacgttctgcgctccccagcc
agcagccagaggcccagcgtttcagatgacactgagcacctggtgaatggccggatggac
tttgcctatccaggcagtgccaactccctgcataggatgactgctgccaacgtggcctat
ggcacacatctaagcccacaccagacccaccgaatgctgagcacgtcttctacccttacc
cgggactaccactctctgacgcgcacagaccactctcagtcaggcacacttccccgggac
tactccactctcacttccctttcctcccaaggcctccctcctatctgggaagatgggagg
agcaggcttccgctgtcctggacccttgggtcctggagccgggctcagatgaagggtgtg
cccgcatccaggggctcaccagactctataatcctggccgggcagtcagcagcgccctcc
tggggtacagattcccgtggggctatgggtgtgcccgacacacccactcggctggtgttc
tccgccctggggcccacatctctgaaggtgagctggcaggagccacagtgtgatcgagca
ctgctgggctacagcgtggaataccagctactcaacggcggcgagatgcatcggctcaac
atccctaaccctggccaaacctctgtggtggtagaggatctcctgcctaaccactcctat
gtgttccgggtgcgggcacaaagccaggagggctggggccgggagcgagagggtgtcatc
accatcgagtcccaggtgcacccgcagagccctctctgccccctgccaggctccgccttc
accttgagcacccccagcgccccaggccccctggtgttcactgccctaagcccagactct
ctgcagctgagctgggagcgcccaagaaggcccaacggagatatccttggctacctggtg
acctgtgagatggcccaaggaggaggaccagccagaaccttccgggtggatggggacaac
cctgagagccggctgacggttcctggcctcagtgagaacgttccttacaagttcaaggtg
caggcccggacaacagagggctttgggcccgagcgtgagggtatcatcaccatcgagtct
caggatggaggccccttcccacagctgggcagccattctgggcttttccagaacccactg
caaagtgagtacagcactgtcaccagcactcacagcactaccaccaccgagcccttcctt
atagatggactaaccctggggacccagcgcctggaagcagggggctccctcacccggcat
gtgacccaggaatttgtgagccggaccctgaccaccagtggctctctcagcactcatatg
gaccaacagttcttccaaacctga

KEGG   Rattus norvegicus (rat): 257645
Entry
257645            CDS       T01003                                 

Gene name
Itgb5
Definition
(RefSeq) integrin beta-5 precursor
  KO
K06588  integrin beta 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04810  Regulation of actin cytoskeleton
rno05165  Human papillomavirus infection
rno05205  Proteoglycans in cancer
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    257645 (Itgb5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    257645 (Itgb5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    257645 (Itgb5)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    257645 (Itgb5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    257645 (Itgb5)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    257645 (Itgb5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    257645 (Itgb5)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    257645 (Itgb5)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    257645 (Itgb5)
   05414 Dilated cardiomyopathy
    257645 (Itgb5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    257645 (Itgb5)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rno04515]
    257645 (Itgb5)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    257645 (Itgb5)
Cell adhesion molecules [BR:rno04515]
 Integrins
  Integrin beta subunits
   257645 (Itgb5)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin I-EGF_1 EGF_2 DUF4232 DUF4242 DUF2975
Other DBs
NCBI-GeneID: 257645
NCBI-ProteinID: NP_671480
RGD: 628869
Ensembl: ENSRNOG00000001795
Position
11
AA seq 799 aa
MPRVPATLYACLLGLCALVPRLAGLNICTSGSATSCEECLLIHPKCAWCSKEYFGNPRSI
ISRCDLKANLIRNGCGGEIESPASSTHVLRNLPLSSKGSSAMGSDVIQMTPQEIAVSLRP
GDQATFQLQVRQVEDYPVDLYYLMDLSLSMKDDLDNIRSLGTKLAEEMRKLTSNFRLGFG
SFVDKDISPFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVS
RNRDAPEGGFDAVLQAAVCKEKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQC
HLNEANEYTASDQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEIL
HGDSKNIIQLIINAYSSIRAKVELSVWDQPEDLNLFFTATCQDGLSYPGQRKCEGLKIGD
TASFEVSVEARSCPGRHTTQSFTLRPVGFRDSLQVEVAYNCTCGCSAGLEPNSARCSGNG
TYVCGLCECDPSYLGTRCECQEGENQSGYQNLCREAEGKPLCSGRGECSCNQCSCFESEF
GRIYGPFCECDSFSCARNKGVLCSGHGECHCGECKCHVGYIGDNCNCSTDISTCRAKDGQ
ICSDRGRCVCGQCQCTEPGAFGETCEKCPTCPDACSSKRDCVECSLLHQGKPDNQTCHHQ
CKDEVITWVDSIVKDDQEAVLCFYKTAKDCVMMFSYTELPNGKSNLTVLREPECGSAPNA
MTILLAVVGSILLVGMALLAIWKLLVTIHDRREFAKFQSERSRARYEMASNPLYRKPIST
HTVDFAFNKFNKSYNGSVD
NT seq 2400 nt   +upstreamnt  +downstreamnt
atgccgcgggtgcccgcgaccctctacgcctgtctgctcgggctctgcgcgctcgtgccg
cgcctcgcagggctcaacatatgcaccagtggaagtgccacctcatgtgaagaatgcctg
ttaatccacccaaaatgtgcctggtgctccaaagagtactttggcaacccacggtccatc
atctctcggtgtgacctgaaggcaaacctcatccgaaatggctgtggaggtgagattgag
agtccggccagcagcacccacgtccttcggaacctgcctctcagcagcaagggttccagt
gccatgggctctgacgtcatccagatgacgccacaggagattgcagtgagcctccgtcca
ggtgaccaggctaccttccagctgcaggtacgccaggtggaggactatcccgtagacctg
tactacctgatggacctctccctctccatgaaggatgacttggacaacatccggagcctg
ggcaccaagcttgcggaggagatgaggaagctcactagtaacttccggttaggtttcggg
tcttttgttgacaaggacatctctccgttctcctacacagcaccgagataccagaccaat
ccatgtattggttacaagttattccccaactgtgtcccttccttcgggttccgccatctg
ctgcctctcacagacagagtggacagtttcaatgaggaagtgaggaagcagagggtgtcc
cggaaccgagatgcccccgaggggggctttgatgctgtcctccaggctgctgtctgcaag
gagaagatcggatggcgaaaggatgccctgcacttgctggtgttcacgacggacgacgtg
ccccacatcgcgttggatggaaaactgggtggcctggtccagccacacgatggccagtgt
cacctgaatgaagccaatgagtacactgcgtccgaccagatggactatccatcgcttgcc
ttgcttggggagaagctggcagagaacaatatcaacctcatctttgcagtgacgaagaac
cactatatgctctacaagaattttacagccctgatacctggaaccactgtggagattttg
catggagattccaaaaatattattcaactgattatcaatgcgtacagtagcatccgggct
aaagtggagctgtcggtctgggatcagccggaagaccttaatctcttcttcactgctacg
tgccaagatggcctatcctaccctggtcagaggaagtgtgagggtctgaagatcggggac
acggcgtcctttgaagtgtctgtggaggctcggagctgccctggcagacatacaacacag
tcttttaccttgaggcctgtgggcttccgggacagtctgcaggtagaagtcgcctacaac
tgcacgtgcggctgtagcgccgggctggagcccaacagtgccagatgcagtgggaatgga
acatacgtctgtgggctgtgcgagtgtgaccccagttacctgggcactaggtgcgagtgc
caggagggcgagaaccagagcgggtaccagaacctgtgccgggaggcggaaggcaaaccc
ctgtgcagcggacgtggggaatgcagctgcaaccagtgctcctgctttgagagtgagttc
gggaggatctacgggcccttctgcgagtgcgacagcttttcctgtgccaggaacaagggc
gtcctatgctcaggccatggcgagtgtcactgcggagaatgcaagtgccacgtcggttac
attggggacaattgtaactgctcaacagacatcagcacgtgcagggccaaggatgggcag
atctgcagcgaccgaggccgttgcgtctgtgggcagtgccagtgcacagagcctggagcc
tttggggagacgtgtgagaagtgcccaacctgccctgatgcttgcagctccaagagagac
tgtgtggaatgctcgctgcttcaccaggggaaacctgacaaccagacctgccaccaccag
tgcaaagatgaggtgatcacgtgggtagacagcattgtcaaagacgaccaggaagctgtg
ctttgcttctacaaaactgctaaggactgcgttatgatgttcagctacacagaactgccc
aatggaaagtctaacttgaccgtcctcagggagccagagtgcggaagtgcccccaatgcc
atgaccatcctgctggctgtggttggcagcatcctcctggttggaatggcactcctggcc
atctggaaactactcgtcaccatccacgaccgtcgagagtttgccaagttccaaagcgag
cgctccagggcccgttatgaaatggcctcaaaccccctgtacagaaagcccatctccaca
catactgtagattttgccttcaacaagttcaacaaatcctacaatggctcagtggactga

KEGG   Rattus norvegicus (rat): 29302
Entry
29302             CDS       T01003                                 

Gene name
Itgb3
Definition
(RefSeq) integrin beta-3 precursor
  KO
K06493  integrin beta 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04145  Phagosome
rno04151  PI3K-Akt signaling pathway
rno04380  Osteoclast differentiation
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno04640  Hematopoietic cell lineage
rno04810  Regulation of actin cytoskeleton
rno04919  Thyroid hormone signaling pathway
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05168  Herpes simplex virus 1 infection
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    29302 (Itgb3)
   04151 PI3K-Akt signaling pathway
    29302 (Itgb3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    29302 (Itgb3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    29302 (Itgb3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    29302 (Itgb3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    29302 (Itgb3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    29302 (Itgb3)
   04611 Platelet activation
    29302 (Itgb3)
   04613 Neutrophil extracellular trap formation
    29302 (Itgb3)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    29302 (Itgb3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    29302 (Itgb3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    29302 (Itgb3)
   05205 Proteoglycans in cancer
    29302 (Itgb3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    29302 (Itgb3)
   05163 Human cytomegalovirus infection
    29302 (Itgb3)
   05165 Human papillomavirus infection
    29302 (Itgb3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    29302 (Itgb3)
   05410 Hypertrophic cardiomyopathy
    29302 (Itgb3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    29302 (Itgb3)
   05414 Dilated cardiomyopathy
    29302 (Itgb3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    29302 (Itgb3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    29302 (Itgb3)
   04515 Cell adhesion molecules [BR:rno04515]
    29302 (Itgb3)
   04090 CD molecules [BR:rno04090]
    29302 (Itgb3)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    29302 (Itgb3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   29302 (Itgb3)
Cell adhesion molecules [BR:rno04515]
 Integrins
  Integrin beta subunits
   29302 (Itgb3)
CD molecules [BR:rno04090]
 Proteins
  29302 (Itgb3)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail I-EGF_1 PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 29302
NCBI-ProteinID: NP_714942
RGD: 628868
UniProt: Q8R2H2
Position
10
AA seq 787 aa
MRTRRPGQLWATLLALGALAGVVVGESNICTTRGVNSCQQCLAVSPVCAWCSDESLPQNS
PRCNLKKNLLKDKCSPESIEFPVSEAQILEALPLSSKGSGDSAQITQVSPQRIALRLRPD
DSKIFSLQVRQVEDYPVDIYYLMDLSFSMKDDLSSIQTLGTKLASQMRKLTSNLRIGFGA
FVDKPVSPYMFISPPQAIKNPCYTMKSTCLPMFGYKHVLTLTDQVTRFNDEVKKQSVSRN
RDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVLPNDGRCHI
GPDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVSLYQNYSELIPGTTVGVLSD
DSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCVGLKIGDTV
SFSIEAKVRGCPQQKEQSFTIKPVGFKDSLTVQVTFDCDCDCQAFAQPLSPRCNNGNGTF
ECGVCRCDQGWLGSMCECSEEDYRPSQQEECSPKEGQPICSQRGECLCGQCVCHSSDFGK
ITGKYCECDDFSCVRYKGEMCSGHGQCNCGDCVCDSDWTGYYCNCTTRTDTCMSTNGLLC
SGRGNCECGSCVCVQPGSYGDTCEKCPTCPDACSFKKDCVECKKFNRGKLHEENNCNRFC
RDDIELVKELTDTGKNAVNCTYKNEDDCVVRFQYYEDSSGRAVLYVVEEPECPKGPDILV
VLLSVMGAILLIGLATLLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFT
NITYRGT
NT seq 2364 nt   +upstreamnt  +downstreamnt
atgcgaacgcggcggccgggacagctctgggccactctgctggcgctgggggcgctggcg
ggcgttgtcgtcggagagtccaacatctgtaccacgagaggcgtgaactcctgccagcag
tgtctggccgtaagtcccgtgtgtgcctggtgctcagatgagtctctgcctcagaactcg
ccccgctgtaacctgaaaaagaacctgctgaaggataagtgctccccagagtctattgag
ttcccagtcagcgaggcccagatcctggaagctcttccgctcagcagcaagggctcagga
gacagcgcccagatcactcaggtcagcccccagaggatcgcccttcggctgcggccagat
gattcgaagatcttttcactccaagtgcggcaggtggaggattaccctgtagacatctac
tacttgatggatctgtctttctccatgaaggatgatctgtccagcatccagaccctgggt
accaagttggcctctcagatgcgcaagcttaccagcaaccttcggattggctttggggcc
tttgtggacaagcccgtgtctccatacatgttcatctccccaccacaggcgatcaaaaac
ccctgttacactatgaagagtacctgcttgcccatgtttggctacaaacatgtgctaaca
ctaaccgaccaggtgacccgcttcaatgacgaagtgaagaagcagagtgtgtcacgtaac
cgagatgccccagagggcggctttgacgccatcatgcaggctacagtctgtgatgaaaaa
attggctggaggaatgatgcatcccatttgctggtgtttaccactgatgccaagacccat
attgccctggacggaaggctggcaggcattgtcttgcccaatgatgggcgctgccacatt
ggcccggacaaccactactctgcttccactactatggattacccatctctggggctgatg
actgagaaactatcccagaagaacattaacttgatctttgcagtgaccgaaaatgtcgtc
agcctttaccagaattacagtgagctcatcccggggaccacagtgggagtcctgtctgat
gactcaagcaatgtccttcagctcatcgttgatgcttacgggaaaatccgttctaaagtg
gagctggaagtgcgtgatctccccgaagagctgtcgctgtccttcaatgccacctgcctc
aacaacgaggtcatcccaggcctcaagtcttgtgtgggcctcaagattggagacacggtg
agcttcagcatcgaggccaaggtgcgtggctgcccccagcagaaggagcaatctttcact
attaagcctgtgggctttaaggacagccttacagtccaggtgaccttcgactgtgactgt
gactgccaggcctttgcccagcctctcagcccacgctgcaacaatggtaacggaaccttt
gagtgtggggtgtgccgctgtgatcagggctggctgggctccatgtgtgagtgctccgag
gaggactatcgaccctctcagcaggaagagtgcagccccaaggaaggccagcccatctgc
agccagcggggcgagtgcctctgtggccagtgcgtctgccacagcagtgactttggcaag
atcaccggcaagtactgtgagtgtgatgacttctcctgtgtccgctacaaaggggagatg
tgctctggccatggccagtgcaactgtggggactgcgtgtgtgactcggactggactggc
tactactgcaactgcacaacacgcaccgacacctgcatgtccaccaacgggctgctgtgc
agcggccggggcaactgtgagtgtggcagctgtgtgtgcgtccagccaggctcctatgga
gacacctgtgagaagtgtcccacctgcccagatgcctgctcatttaagaaggactgtgtg
gagtgtaagaagttcaaccggggaaagctacatgaagaaaacaactgcaaccgtttctgc
cgagatgacatcgagctggtgaaagaactgacggatactggcaaaaacgcggtgaactgt
acctacaagaatgaggacgactgtgtcgtcagattccagtactatgaagactccagtgga
agggctgtcctgtatgtggtagaagagcctgagtgtcctaagggtcctgatatcctggtg
gtcctgctgtcagtgatgggggcgattctgctcattggccttgctactctgctcatctgg
aagctactcatcaccattcatgaccggaaggaatttgctaaatttgaggaagaacgagcc
agagccaaatgggacacagcaaacaacccattgtataaagaggccacctccaccttcacc
aatatcacctaccgggggacttaa

KEGG   Rattus norvegicus (rat): 311061
Entry
311061            CDS       T01003                                 

Gene name
Itgb6
Definition
(RefSeq) integrin beta-6 precursor
  KO
K06589  integrin beta 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04810  Regulation of actin cytoskeleton
rno05165  Human papillomavirus infection
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    311061 (Itgb6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    311061 (Itgb6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    311061 (Itgb6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    311061 (Itgb6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    311061 (Itgb6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    311061 (Itgb6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    311061 (Itgb6)
   05414 Dilated cardiomyopathy
    311061 (Itgb6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    311061 (Itgb6)
   04515 Cell adhesion molecules [BR:rno04515]
    311061 (Itgb6)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   311061 (Itgb6)
Cell adhesion molecules [BR:rno04515]
 Integrins
  Integrin beta subunits
   311061 (Itgb6)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin I-EGF_1 EGF_2
Other DBs
NCBI-GeneID: 311061
NCBI-ProteinID: NP_001004263
RGD: 1303119
Ensembl: ENSRNOG00000008346
UniProt: Q6AYF4
Position
3
AA seq 787 aa
MGIELVCLFLLLLGRNDHVQGGCAWSGAETCSDCLLTGPHCAWCSQENFTHLSGAGERCD
TPENLLAKGCQLPFIENPVSQVEILQNKPLSVGRQKNSSDIVQIAPQSLVLKLRPGGEQT
LQVQVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLAKEMSKLTSNFRLGFGSFVEK
PVSPFMKTTPEEITNPCSSIPYFCLPTFGFKHILPLTDDAERFNEIVRKQKISANIDTPE
GGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDNRNE
YSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNI
LQLIISAYEELRSEVELEVLGDTEGLNLSFTALCSNGILFPHQKKCSHMKVGDTASFNVS
VSITNCEKRSRKLIIKPVGLGDTLEILVSAECDCDCQREVEANSSKCHHGNGSFQCGVCA
CNPGHMGPRCECGEDMVSTDSCKESPGHPSCSGRGDCYCGQCVCHLSPYGSIYGPYCQCD
NFSCLRHKGLLCGDNGDCDCGECVCRDGWTGEYCNCTTSRDACASEDGVLCSGRGDCVCG
KCVCRNPGASGPTCERCPTCGDPCNSRRSCIECYLSADGQAQEECEDKCKATGATISEEE
FSKDTSVPCSLQGENECLITFLITADNEGKTIIHNISEKDCPKPPNIPMIMLGVSLAILL
IGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYKHREKHK
VGLSSDG
NT seq 2364 nt   +upstreamnt  +downstreamnt
atggggattgagctggtctgcctgttcctgctacttctaggaaggaatgatcacgtccaa
ggtggctgtgcctggagtggtgcagaaacctgctcagactgcctgctcacaggacctcac
tgcgcctggtgctcccaggagaatttcacccacctgtccggagctggcgaaaggtgcgac
acccccgagaatcttttagccaaaggatgtcagttacccttcatcgaaaaccctgtctcc
caagtagaaatacttcaaaataagcctctcagcgtaggtcgacagaaaaacagttctgac
attgttcagattgctcctcaaagcttggttcttaagttgagaccagggggtgagcagact
ctgcaagtgcaggtccgccagacggaagattacccagtagatctgtattacctcatggac
ctctcggcctccatggatgatgacctcaacacaatcaaagagcttggctcccggctggcc
aaagagatgtctaaattaaccagcaactttagactgggctttggctcttttgtggaaaag
cccgtttctccttttatgaaaacaacaccagaggaaatcaccaacccttgcagtagtatc
ccctatttctgcttacctacatttggattcaagcacattttgccattgactgatgatgct
gagagattcaatgaaattgtgaggaaacagaagatttccgctaatattgacacgcctgaa
ggcggattcgatgccatcatgcaagctgctgtgtgtaaggaaaagattggctggcgcaac
gactcgctccacctcctggtttttgtgagtgatgctgattctcattttggaatggacagc
aagctggcaggcattgtgattcccaacgatgggctctgtcacttggacaacaggaatgaa
tactccatgtcaactgtcttggaatatccaacgatcggccaactcattgataaactggta
caaaacaacgtgctactgatctttgcggtcacccaagaacaagtccatctctatgagaat
tatgcgaaactcatccctggagcgactgtgggactgcttcagaaggattctgggaacatt
cttcagctgatcatctccgcttacgaagaactgcggtctgaggtggaactagaagtatta
ggagacacagaaggactcaacctgtctttcacagctctctgtagcaatggcatcctcttc
ccacaccaaaagaagtgttcccacatgaaagtcggagatacagcatccttcaacgtgtct
gtgagcataacaaactgtgagaaaagaagcaggaaacttatcatcaagcctgtgggactt
ggggacaccctggaaatactcgtcagcgcagaatgtgactgcgactgccagagagaagta
gaagccaacagttctaagtgccaccacgggaatggctccttccagtgtggggtgtgtgcc
tgcaaccctggccacatgggtcctcgctgcgagtgcggcgaggacatggtgagcacggat
tcctgcaaggagtccccaggtcacccctcctgcagcggaaggggtgactgctattgtggg
cagtgtgtctgccacttgtctccctatggaagcatctatggaccttactgccagtgtgac
aacttctcctgtctgagacacaaaggcctgctctgtggagataatggtgactgtgactgt
ggtgaatgcgtgtgccgggatggctggacgggcgagtactgcaactgtacaaccagcagg
gatgcgtgtgcatcggaagatggcgtgctgtgcagcgggcgtggggactgtgtctgcggc
aagtgtgtctgcagaaaccctggagcctcgggacccacctgtgaacgctgccctacctgt
ggagacccctgtaactcgagacggagctgcatcgagtgctacctgtctgcagatggccag
gcccaagaagagtgcgaggacaagtgcaaagccaccggtgccaccatcagtgaggaagag
ttttcaaaggatacttctgtcccctgctcgctacaaggagaaaatgaatgtcttattaca
ttcctaataactgcggataatgaagggaaaaccatcattcacaacatcagtgaaaaagac
tgccccaaacctccaaacattcccatgatcatgttgggggtgtcactggctatcctgctc
atcggtgtcgtgctactgtgcatttggaagctgctggtatcctttcacgaccggaaagaa
gttgctaaatttgaagcagaacgatcaaaggccaagtggcaaacgggaaccaatccgctg
taccgaggctccaccagcacttttaagaacgtgacctacaaacacagggagaagcacaaa
gtgggcctttcttcagatgggtag

KEGG   Rattus norvegicus (rat): 362800
Entry
362800            CDS       T01003                                 

Gene name
Itgb8
Definition
(RefSeq) integrin beta-8
  KO
K06591  integrin beta 8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04514  Cell adhesion molecules
rno04810  Regulation of actin cytoskeleton
rno05165  Human papillomavirus infection
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    362800 (Itgb8)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    362800 (Itgb8)
   04514 Cell adhesion molecules
    362800 (Itgb8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    362800 (Itgb8)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    362800 (Itgb8)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    362800 (Itgb8)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    362800 (Itgb8)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    362800 (Itgb8)
   05414 Dilated cardiomyopathy
    362800 (Itgb8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    362800 (Itgb8)
   04515 Cell adhesion molecules [BR:rno04515]
    362800 (Itgb8)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   362800 (Itgb8)
Cell adhesion molecules [BR:rno04515]
 Integrins
  Integrin beta subunits
   362800 (Itgb8)
SSDB
Motif
Pfam: Integrin_beta EGF_2
Other DBs
NCBI-GeneID: 362800
NCBI-ProteinID: NP_001102196
RGD: 1311374
Ensembl: ENSRNOG00000006569
UniProt: D3ZP06
Position
6
AA seq 560 aa
MLKIRPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSKKMALFSHDFRLGFGSYVDKT
VSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKAVHRQKISGNIDTPEG
GFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVVPNDGNCHLKNNVYV
KSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGAIAGEIESKAANLNN
LVVEAYKVLFNVTVVMKTCDIIGGKNYAIIKPIGFNETTKVHIHRSCSCQCEDHRGLKGQ
CAEAAPDPKCPQCDDGKCHFDEDQFPSEACKPQEDQPVCSGRGVCICGKCLCHKTKLGRV
YGQYCEKDDFSCPYLHGDVCSGHGECEGGRCQCFNGWEGDRCQCPSASAQHCVNSKGQVC
SGRGTCVCGRNCLQCLHPHNLSQAVLDQCKASCAVMEQHPVAQTSECLSGPSYLRIFFII
FIVTFLIGLLKVLIIRQVILQWNSNKIKSSSDYRVSASKKDKLILQSVCTRAVTYRREKP
EEIKMDISKLNAQEAFRCNF
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgctaaaaatccgtcccctgaagaagtaccctgtggatctttattatctggttgatgtg
tcagcatcaatgcacaataatatagaaaaattgaattccgttggaaacgatttatctaaa
aaaatggcccttttttcccatgacttccgtcttggttttggctcatatgtggataaaact
gtctcaccatacattagtatccacccggaaaggatccacaatcagtgcagtgactacaat
ttagactgtatgcctccccatggatacattcatgtgctgtctctgacagaaaacatcact
gagtttgaaaaagcagtccacagacaaaagatctctggaaacatagacactcctgaagga
ggttttgatgccatgcttcaggctgccgtctgtgagagtcatattggatggcgaaaagaa
gctaaaagattgctgctggtgatgacagaccagacatcacatctcgctcttgacagcaaa
ttggcaggcatagtggtgccaaatgacggaaactgccatctgaaaaacaatgtctacgtc
aaatcaacaaccatggaacatccatcattaggtcaactttccgaaaagttaatagacaac
aacataaatgtcatttttgcagttcaaggaaagcagtttcattggtacaaggaccttctg
ccccttttgcctggtgccattgctggtgaaatagaatccaaagctgcaaatctcaacaat
ttagtagtagaagcctacaaggttcttttcaatgtgacagttgtgatgaaaacatgtgat
atcataggaggaaaaaactatgcaataatcaaacctattggtttcaatgaaaccactaaa
gtccacatacacagaagctgcagttgccagtgtgaggaccacagaggactcaaaggacag
tgtgcggaagctgctccagatcccaagtgtccacagtgtgatgacggcaaatgtcatttt
gatgaagaccagtttccttccgaagcttgcaagccacaggaggaccaacctgtctgcagt
ggccgaggtgtttgtatctgtgggaaatgtttatgtcacaaaaccaagcttggaagagtg
tatggccaatactgtgagaaggatgacttctcttgtccctatctccatggagatgtgtgt
tctggacatggggagtgcgaaggtggcagatgccagtgctttaacggctgggaaggggat
cggtgtcagtgtccatcagcctcagcacagcactgtgtcaactccaagggccaagtttgc
agcgggagaggcacctgcgtttgtggcaggaattgtctacagtgccttcaccctcacaat
ctgtctcaagctgttcttgatcagtgtaaagcctcctgtgctgtcatggaacaacatcct
gtggcccaaacatcagagtgtttatctggcccaagctatctgcgaatatttttcatcata
ttcatagtgacattcttgattgggttgcttaaagttcttatcattagacaagtgatacta
cagtggaatagtaataaaataaagtcctcatcagattacagagtgtctgcttccaaaaag
gataaactgattctgcaaagtgtttgcacgagagctgtaacctaccgacgagaaaagcct
gaggaaataaaaatggatatcagcaaactaaacgcccaggaggctttcaggtgcaacttc
taa

DBGET integrated database retrieval system