KEGG   Rattus norvegicus (rat): 24575
Entry
24575             CDS       T01003                                 

Gene name
Mx1
Definition
(RefSeq) interferon-induced GTP-binding protein Mx1
  KO
K14754  interferon-induced GTP-binding protein Mx
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05160  Hepatitis C
rno05162  Measles
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    24575 (Mx1)
   05171 Coronavirus disease - COVID-19
    24575 (Mx1)
   05164 Influenza A
    24575 (Mx1)
   05162 Measles
    24575 (Mx1)
   05165 Human papillomavirus infection
    24575 (Mx1)
SSDB
Motif
Pfam: Dynamin_M Dynamin_N GED MMR_HSR1 AAA_21 AAA_29 Egg_lysin AAA_16
Other DBs
NCBI-GeneID: 24575
NCBI-ProteinID: NP_001257987
RGD: 3127
Ensembl: ENSRNOG00000001959
UniProt: Q499S4
Position
11
AA seq 652 aa
MKEQTSACRHQTPQKHPDTSEESQAMESVDNLCSQYEEKVRPCIDLIDSLRALGVEQDLA
LPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKQLKQGEKWSGKVIYKDT
EIEISHPSLVEREINKAQNLIAGEGLKISSDLISLEVSSPHVPDLTLIDLPGITRVAVGD
QPADIEHKIKRLITEYIQKQETINLVVVPSNVDIATTEALKMAQEVDPQGDRTIGILTKP
DLVDRGTEDKVVDVVRNLVCHLKKGYMIVKCRGQQDIQEQLSLAEALQKEQVFFKEHPQF
RVLLEDGKATVPCLAKRLTMELTSHICKSLPILENQINVNHQIASEELQKYGADIPEDDS
KRLSFLMNKINVFNKDILSLVQAQENISWEESRLFTKLRNEFLAWNDYIEEHFKKTLGSS
EKHSQMEKFESHYRGRELPGFVDYKAFENIIKKEVKALEEPALNMLHRVTTMVKNAFTKV
SSNNFGDFLNLHSTAKSKIEDIRFSQEKEAEKLIRLHFQMEHIVYCQDQAYKKALKEIRE
KEAEKEKSTFGVFQQNSPRKELTTTEMTQHLNAYYQECGRNIGRQIPLIIQYSILQTFGQ
EMEKAMLQLLQDTSKCNWFLTEQSDSREKKKFLKRRLLRLDEAQRKLAKFSN
NT seq 1959 nt   +upstreamnt  +downstreamnt
atgaaggagcagacctctgcatgccgtcaccagacaccacagaaacatcctgatacctct
gaagagagccaggcaatggagtctgtggataacctctgcagtcagtatgaggagaaggtg
cggccctgcattgacctcatcgactccctgcgagctctgggtgtggagcaagacctggcc
ctgcctgccatcgctgtcatcggggaccagagttcagggaagagctctgtgctggaagca
ctgtctggagtggccctccccagaggcagtggtattgttaccaggtgtcctctggtgctg
aaattgaagcaactgaagcagggagaaaaatggagcggcaaggtcatttataaggacacc
gagattgagatctcacacccttcactggtagaaagggaaatcaataaagcccagaacttg
attgctggggaagggttgaagattagctctgatctcattagcttggaggttagctctcca
catgtcccagacctgactctgattgaccttcctggtatcacaagagtggctgtgggtgac
cagcctgcagacatcgaacacaagatcaagagacttatcactgaatacatccagaaacag
gagaccatcaacctggtggtggtccccagcaatgtggacattgccaccacagaggccctg
aaaatggctcaggaggtggaccctcaaggggatagaaccatagggatcttgaccaagccc
gatctggtggacagagggactgaagacaaggtcgtggatgtggtgcggaacctcgtgtgc
cacctgaagaagggctacatgatagtcaagtgcaggggtcagcaggacatccaggagcag
ctgagcctggctgaggctcttcagaaggagcaagtcttcttcaaggaacaccctcaattc
agagttcttctcgaggatgggaaggccacagtgccctgcttggcaaagagactgaccatg
gagctcacctcccacatctgtaaatcgctgccaatattggaaaatcaaataaatgtgaat
catcagattgcgagtgaggagctgcagaagtacggagcagacataccagaagatgacagt
aagaggctgtcctttctgatgaataaaatcaatgtcttcaataaggatatcctaagtttg
gtacaagcacaagaaaacatatcatgggaagaaagccggctgttcaccaaactgcgaaat
gagtttcttgcttggaatgattatattgaggaacatttcaaaaaaaccctaggttcttct
gagaaacacagccagatggaaaaatttgaaagtcattatcgtggccgggaactgccaggg
tttgtggactataaggcatttgagaacattatcaagaaggaagtcaaggccctggaagaa
cccgctctgaacatgctgcacagggtcactaccatggtcaaaaatgccttcacaaaggtt
tcatcaaacaattttggtgattttttaaacctccacagtactgccaagtccaaaattgaa
gacatcagatttagccaagaaaaagaagccgaaaaactgatccgacttcacttccagatg
gaacacattgtctactgccaggaccaggcttacaagaaagccttgaaggagatcagagag
aaggaagctgagaaagagaagtcaacctttggtgtctttcaacaaaactctcctcgaaag
gagttgactaccactgagatgacccagcacctgaatgcctactaccaggagtgcggaagg
aacattgggagacagatccctctgatcatccagtactccatcctgcaaacatttgggcag
gaaatggagaaagcaatgcttcagcttctacaggacaccagtaagtgcaactggttcctg
actgagcagagtgacagcagagagaagaagaagttcctgaagaggcggcttttaaggctg
gatgaggctcagcggaagcttgccaaattctccaattaa

KEGG   Rattus norvegicus (rat): 286918
Entry
286918            CDS       T01003                                 

Gene name
Mx2
Definition
(RefSeq) interferon-induced GTP-binding protein Mx2
  KO
K14754  interferon-induced GTP-binding protein Mx
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05160  Hepatitis C
rno05162  Measles
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    286918 (Mx2)
   05171 Coronavirus disease - COVID-19
    286918 (Mx2)
   05164 Influenza A
    286918 (Mx2)
   05162 Measles
    286918 (Mx2)
   05165 Human papillomavirus infection
    286918 (Mx2)
SSDB
Motif
Pfam: Dynamin_M Dynamin_N GED MMR_HSR1 AAA_21 CHDNT AAA_29 ABC_tran AAA_16
Other DBs
NCBI-GeneID: 286918
NCBI-ProteinID: NP_599177
RGD: 628821
Ensembl: ENSRNOG00000001963
UniProt: Q499Q3
Position
11
AA seq 659 aa
MVLSTEENRSVDLVNLPSVPLPDGEAGVGENNKDSLNNLCSQYEEKVRPCIDLIDSLRAL
GVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKLNQGEEWKG
KVTYDDIEVELSDPSEVEEAINTGQNHIAGVGLGISDKLISLDVSSPHVPDLTLIDLPGI
TRVAVGNQPADIGRQIKRLITNYIQKQETINLVVVPSNVDIATTEALSMAQKVDPDGDRT
IGILTKPDLVDRGTEDKVVDVVRNLVCHLKKGYMIVKCRGQQDIQEQLSLAEALQKEQVF
FKEHPQFRALLEDGKATVPCLAERLTMELISHICKSLPLLENQIKESHQSTSEELQKYGA
DIPEDENEKTLFLIEKINAFNQDITAIVEGEEIVREKECRLFTKLRKEFFLWSEEIERNF
QKGSDALYKEVYTFEMQYRGRELPGFVNYKTFENIIRRQIKTLEEPAMEMLHKVTEIVRA
AFTTVSEKNFSEFFNLHRTTKSKLEDIRLEQETEAEKAIRLHFQMEQIIYCQDQIYRKAL
QKVREEEAEEEERKHGKSRSAQSPNLQTSSMDEIFQHLNAYRQEAHNCISSHIPLIIQYF
ILKMFAEKLQKGMLQLLQDKDSCSWLLKEKSDTSEKRRFLKERLARLAQAQRRLAKFPG
NT seq 1980 nt   +upstreamnt  +downstreamnt
atggttcttagcacagaggaaaacaggagtgttgatttagtcaacttacccagtgtccca
ctgcccgatggagaggctggcgtaggggagaacaacaaggattccttgaacaacctctgc
agtcagtatgaggagaaggtgcggccctgcattgacctcatcgactccctgcgagctctg
ggtgtggagcaagacctggccctgcctgccatcgctgtcatcggggaccagagttcaggg
aagagctctgtgctggaagcactgtctggagtggccctccccagaggcagtggtattgtc
accagatgtcccctggtgctgaaattgaagaagctgaatcagggagaggagtggaaaggc
aaagtcacctatgatgacatcgaagtggagctctctgatccttcagaggtggaagaggcc
atcaacacaggtcagaaccatattgctggggtagggctggggatcagtgataaactcatt
agcctggatgtcagctccccacacgtcccagacctgactctgattgaccttcctggaatc
accagggtggctgtaggcaaccagcctgcagacataggacggcagatcaagagacttatc
actaactacatccaaaaacaagagaccatcaacctggtggtggtccccagcaatgtggac
attgccaccacagaggccctgagcatggctcagaaggtggaccctgatggggataggacc
atagggatcttgaccaagcctgatctggtggacagagggactgaagacaaggtcgtggat
gtggtgaggaacctcgtgtgccacctgaagaagggctacatgatagtcaagtgcaggggt
cagcaggacatccaggagcagctgagcctggctgaggctcttcagaaggagcaagtcttc
ttcaaggaacaccctcaattcagagctcttctggaggatgggaaggccacagtgccctgc
ctggcagagaggctgaccatggagctcatctcacacatctgtaaatctcttcctttgtta
gaaaatcaaataaaggaaagtcaccagagtacaagtgaggagctgcagaagtatggtgca
gacataccagaagatgagaatgaaaaaactctcttcctgattgaaaaaatcaatgctttt
aaccaggacatcactgccatagtagaaggggaagagattgtgagggagaaagaatgtcgc
ctattcaccaagctccgtaaagagttcttcttgtggagtgaggagatcgaaaggaatttc
caaaaaggttctgatgctttatataaagaagtctacacattcgaaatgcagtatcgtggc
cgagaactaccagggtttgtgaattacaaaacatttgagaacatcataagaagacaaatc
aaaaccctggaagaaccagctatggaaatgcttcacaaggtcactgaaattgtacgggct
gcctttacaacggtttctgagaaaaatttctctgagttttttaatctccacagaactacc
aagtccaaacttgaagacatcagattagaacaggaaacggaagcagagaaggcgatccgg
cttcacttccagatggaacaaatcatctactgccaggaccaaatttataggaaagccttg
cagaaggtgagagaggaggaagctgaggaggaggagaggaagcatggcaaaagcaggtcc
gctcagtccccaaatttacagacctcatccatggatgaaatcttccagcatctgaatgcc
taccgccaggaggctcacaactgcatctccagccacattccattgatcatccagtatttc
atcttgaagatgtttgctgagaagctgcagaagggcatgctccagctcctgcaggacaag
gattcctgcagctggctcctgaaggaaaagagtgacaccagtgagaagaggagattcctg
aaggagcggttggcaaggctggcccaagctcagcgcaggctagccaaattccctggttaa

DBGET integrated database retrieval system