KEGG   Rattus norvegicus (rat): 24577
Entry
24577             CDS       T01003                                 

Gene name
Myc
Definition
(RefSeq) myc proto-oncogene protein
  KO
K04377  Myc proto-oncogene protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04110  Cell cycle
rno04151  PI3K-Akt signaling pathway
rno04218  Cellular senescence
rno04310  Wnt signaling pathway
rno04350  TGF-beta signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04630  JAK-STAT signaling pathway
rno04919  Thyroid hormone signaling pathway
rno05132  Salmonella infection
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05207  Chemical carcinogenesis - receptor activation
rno05210  Colorectal cancer
rno05213  Endometrial cancer
rno05216  Thyroid cancer
rno05219  Bladder cancer
rno05220  Chronic myeloid leukemia
rno05221  Acute myeloid leukemia
rno05222  Small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24577 (Myc)
   04012 ErbB signaling pathway
    24577 (Myc)
   04310 Wnt signaling pathway
    24577 (Myc)
   04350 TGF-beta signaling pathway
    24577 (Myc)
   04390 Hippo signaling pathway
    24577 (Myc)
   04630 JAK-STAT signaling pathway
    24577 (Myc)
   04151 PI3K-Akt signaling pathway
    24577 (Myc)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    24577 (Myc)
   04218 Cellular senescence
    24577 (Myc)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    24577 (Myc)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    24577 (Myc)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24577 (Myc)
   05202 Transcriptional misregulation in cancer
    24577 (Myc)
   05206 MicroRNAs in cancer
    24577 (Myc)
   05205 Proteoglycans in cancer
    24577 (Myc)
   05207 Chemical carcinogenesis - receptor activation
    24577 (Myc)
   05230 Central carbon metabolism in cancer
    24577 (Myc)
  09162 Cancer: specific types
   05210 Colorectal cancer
    24577 (Myc)
   05225 Hepatocellular carcinoma
    24577 (Myc)
   05226 Gastric cancer
    24577 (Myc)
   05216 Thyroid cancer
    24577 (Myc)
   05221 Acute myeloid leukemia
    24577 (Myc)
   05220 Chronic myeloid leukemia
    24577 (Myc)
   05219 Bladder cancer
    24577 (Myc)
   05213 Endometrial cancer
    24577 (Myc)
   05224 Breast cancer
    24577 (Myc)
   05222 Small cell lung cancer
    24577 (Myc)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    24577 (Myc)
   05161 Hepatitis B
    24577 (Myc)
   05160 Hepatitis C
    24577 (Myc)
   05163 Human cytomegalovirus infection
    24577 (Myc)
   05167 Kaposi sarcoma-associated herpesvirus infection
    24577 (Myc)
   05169 Epstein-Barr virus infection
    24577 (Myc)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    24577 (Myc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    24577 (Myc)
   03019 Messenger RNA biogenesis [BR:rno03019]
    24577 (Myc)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    24577 (Myc)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     24577 (Myc)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH
Other DBs
NCBI-GeneID: 24577
NCBI-ProteinID: NP_036735
RGD: 3130
UniProt: P09416
Position
7
AA seq 453 aa
MNFLWEVENPTVTTMPLNVSFANRNYDLDYDSVQPYFICDEEENFYHQQQQSELQPPAPS
EDIWKKFELLPTPPLSPSRRSGLCSPSYVAVATSFSPREDDDGGGGNFSTADQLEMMTEL
LGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSTSLSPA
RGHSVCSTSSLYLQDLTAAASECIDPSVVFPYPLNDSSSPKSCTSSDSTAFSSSSDSLLS
SESSPRATPEPLVLHEETPPTTSSDSEEEQDDEEEIDVVSVEKRQPPAKRSESGSSPSRG
HSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNRKCSSPR
SSDTEENDKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSV
QADEHKLISEKDLLRKRREQLKHKLEQLRNSGA
NT seq 1362 nt   +upstreamnt  +downstreamnt
ctgaatttcctttgggaggtggaaaacccgacagtcacgacgatgcccctcaacgtgagc
ttcgctaacaggaactatgacctcgactacgactcggtgcagccctatttcatctgcgac
gaggaagagaatttctatcaccagcaacagcagagcgagctgcagccgcccgcacccagt
gaggatatctggaagaaattcgagctgctgcccaccccgcccctgtcccccagccgccgc
tccgggctctgctctccgtcctatgttgcggtcgctacgtccttctccccaagggaggac
gatgacggtggcggtggcaacttctccaccgccgatcagctggagatgatgaccgagcta
cttggaggagacatggtgaatcagagcttcatctgcgatcctgacgatgagaccttcatc
aagaacatcatcatccaggactgtatgtggagcggcttctcggccgctgccaaactggtc
tccgagaagctggcctcttaccaggctgcgcgcaaagacagcaccagcctgagccccgcc
cgcgggcacagcgtctgctccacctccagcctgtacctgcaggacctcaccgccgcagcg
tccgagtgcatcgacccctcagtggtcttcccctacccgctcaacgacagcagctcgccc
aaatcctgtacctcgtccgattccacggccttctcttcttcctcggactcgctgctgtcc
tccgagtcctccccacgggccacccctgagcccctagtgctgcatgaagagacaccgccc
accaccagcagcgactctgaagaagaacaagatgatgaggaagaaattgatgtggtgtct
gtggaaaagaggcaaccccctgccaagaggtccgagtcagggtcatccccatcaagaggc
cacagcaaacctccacacagcccactggtcctcaagaggtgccatgtctctactcaccag
cacaattatgcagcacccccctccacaaggaaggactatccagctgccaagagggccaag
ttggacagtggcagggtcctgaaacagatcagcaacaaccgcaaatgctccagccccagg
tcctcagacaccgaggaaaacgacaagaggcggacacacaacgtcttggaacgtcagagg
agaaacgagctgaagcgtagcttttttgccctgcgcgaccagatccctgagttggaaaac
aacgaaaaggcccccaaggtagttatcctcaaaaaagccaccgcctacatcctgtccgtt
caagcagatgagcacaaactcatctcagaaaaggacttactgaggaaacggcgagaacag
ttgaaacacaaactcgaacagcttcgaaactctggtgcataa

DBGET integrated database retrieval system