KEGG   Rattus norvegicus (rat): 24604
Entry
24604             CDS       T01003                                 

Symbol
Npy
Name
(RefSeq) pro-neuropeptide Y preproprotein
  KO
K05232  neuropeptide Y
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04920  Adipocytokine signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    24604 (Npy)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24604 (Npy)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    24604 (Npy)
   04920 Adipocytokine signaling pathway
    24604 (Npy)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    24604 (Npy)
SSDB
Motif
Pfam: Hormone_3
Other DBs
NCBI-GeneID: 24604
NCBI-ProteinID: NP_036746
RGD: 3197
Ensembl: ENSRNOG00000009768
UniProt: P07808 F2W8A6
Position
4
AA seq 98 aa
MMLGNKRMGLCGLTLALSLLVCLGILAEGYPSKPDNPGEDAPAEDMARYYSALRHYINLI
TRQRYGKRSSPETLISDLLMRESTENAPRTRLEDPSMW
NT seq 297 nt   +upstreamnt  +downstreamnt
atgatgctaggtaacaaacgaatggggctgtgtggactgaccctcgctctatccctgctc
gtgtgtttgggcattctggctgaggggtacccctccaagccggacaatccgggcgaggac
gcgccagcagaggacatggccagatactactccgctctgcgacactacatcaatctcatc
accagacagagatatggcaagagatccagccctgagacactgatttcagatctcttaatg
agagaaagcacagaaaatgcccccagaacaaggcttgaagacccttccatgtggtga

DBGET integrated database retrieval system