KEGG   Rattus norvegicus (rat): 24887
Entry
24887             CDS       T01003                                 

Gene name
Bax
Definition
(RefSeq) apoptosis regulator BAX
  KO
K02159  apoptosis regulator BAX
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno01524  Platinum drug resistance
rno04071  Sphingolipid signaling pathway
rno04115  p53 signaling pathway
rno04141  Protein processing in endoplasmic reticulum
rno04210  Apoptosis
rno04211  Longevity regulating pathway
rno04215  Apoptosis - multiple species
rno04217  Necroptosis
rno04722  Neurotrophin signaling pathway
rno04932  Non-alcoholic fatty liver disease
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05203  Viral carcinogenesis
rno05210  Colorectal cancer
rno05212  Pancreatic cancer
rno05213  Endometrial cancer
rno05214  Glioma
rno05216  Thyroid cancer
rno05217  Basal cell carcinoma
rno05218  Melanoma
rno05220  Chronic myeloid leukemia
rno05222  Small cell lung cancer
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    24887 (Bax)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    24887 (Bax)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    24887 (Bax)
   04215 Apoptosis - multiple species
    24887 (Bax)
   04217 Necroptosis
    24887 (Bax)
   04115 p53 signaling pathway
    24887 (Bax)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    24887 (Bax)
  09149 Aging
   04211 Longevity regulating pathway
    24887 (Bax)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24887 (Bax)
   05202 Transcriptional misregulation in cancer
    24887 (Bax)
   05203 Viral carcinogenesis
    24887 (Bax)
  09162 Cancer: specific types
   05210 Colorectal cancer
    24887 (Bax)
   05212 Pancreatic cancer
    24887 (Bax)
   05225 Hepatocellular carcinoma
    24887 (Bax)
   05226 Gastric cancer
    24887 (Bax)
   05214 Glioma
    24887 (Bax)
   05216 Thyroid cancer
    24887 (Bax)
   05220 Chronic myeloid leukemia
    24887 (Bax)
   05217 Basal cell carcinoma
    24887 (Bax)
   05218 Melanoma
    24887 (Bax)
   05213 Endometrial cancer
    24887 (Bax)
   05224 Breast cancer
    24887 (Bax)
   05222 Small cell lung cancer
    24887 (Bax)
   05223 Non-small cell lung cancer
    24887 (Bax)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    24887 (Bax)
   05170 Human immunodeficiency virus 1 infection
    24887 (Bax)
   05161 Hepatitis B
    24887 (Bax)
   05160 Hepatitis C
    24887 (Bax)
   05164 Influenza A
    24887 (Bax)
   05162 Measles
    24887 (Bax)
   05168 Herpes simplex virus 1 infection
    24887 (Bax)
   05163 Human cytomegalovirus infection
    24887 (Bax)
   05167 Kaposi sarcoma-associated herpesvirus infection
    24887 (Bax)
   05169 Epstein-Barr virus infection
    24887 (Bax)
   05165 Human papillomavirus infection
    24887 (Bax)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    24887 (Bax)
   05152 Tuberculosis
    24887 (Bax)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    24887 (Bax)
   05014 Amyotrophic lateral sclerosis
    24887 (Bax)
   05016 Huntington disease
    24887 (Bax)
   05020 Prion disease
    24887 (Bax)
   05022 Pathways of neurodegeneration - multiple diseases
    24887 (Bax)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    24887 (Bax)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    24887 (Bax)
   04933 AGE-RAGE signaling pathway in diabetic complications
    24887 (Bax)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    24887 (Bax)
   01524 Platinum drug resistance
    24887 (Bax)
   01522 Endocrine resistance
    24887 (Bax)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    24887 (Bax)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    24887 (Bax)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    24887 (Bax)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   24887 (Bax)
SSDB
Motif
Pfam: Bcl-2 CF222 Bclx_interact
Other DBs
NCBI-GeneID: 24887
NCBI-ProteinID: NP_058755
RGD: 2192
Ensembl: ENSRNOG00000020876
UniProt: G3V8T9 Q9JKL3
Position
1
AA seq 192 aa
MDGSGDHLGGGGPTSSEQIMKTGAFLLQGFIQDRAERMAGETPELTLEQPPQDASTKKLS
ECLRRIGDELDNNMELQRMIADVDTDSPREVFFRVAADMFADGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTLDFLRERLLVWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV
LTASLTIWKKMG
NT seq 579 nt   +upstreamnt  +downstreamnt
atggacgggtccggggatcatctcggaggcggcgggcccaccagctctgaacagatcatg
aagacaggggcctttttgctacagggtttcatccaggatcgagcagagaggatggctggg
gagacacctgagctgaccttggagcagccgccccaggacgcatccaccaagaagctgagc
gagtgtctcaggcgaattggcgatgaactggacaacaacatggagctgcagaggatgatt
gctgatgtggatacagactccccccgagaggtcttcttccgtgtggcagctgacatgttt
gcagacggcaacttcaactggggccgggtggttgcccttttctactttgctagcaaactg
gtgctcaaggccctgtgcactaaagtgcccgagctgatcagaaccatcatgggctggaca
ctggacttcctccgggagcggctgcttgtctggatccaagaccagggtggctgggatggc
ctcctttcctacttcgggacccccacatggcagacagtgaccatctttgtggctggagtc
ctcactgcctcactcaccatctggaagaagatgggctga

DBGET integrated database retrieval system