KEGG   Rattus norvegicus (rat): 24890
Entry
24890             CDS       T01003                                 

Gene name
Esr1
Definition
(RefSeq) estrogen receptor
  KO
K08550  estrogen receptor alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04915  Estrogen signaling pathway
rno04917  Prolactin signaling pathway
rno04919  Thyroid hormone signaling pathway
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05207  Chemical carcinogenesis - receptor activation
rno05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    24890 (Esr1)
   04917 Prolactin signaling pathway
    24890 (Esr1)
   04919 Thyroid hormone signaling pathway
    24890 (Esr1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    24890 (Esr1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24890 (Esr1)
   05205 Proteoglycans in cancer
    24890 (Esr1)
   05207 Chemical carcinogenesis - receptor activation
    24890 (Esr1)
  09162 Cancer: specific types
   05224 Breast cancer
    24890 (Esr1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    24890 (Esr1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    24890 (Esr1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rno03310]
    24890 (Esr1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    24890 (Esr1)
Nuclear receptors [BR:rno03310]
 3. Estrogen like
  3A. Estrogen receptor
   24890 (Esr1)
SSDB
Motif
Pfam: Oest_recep Hormone_recep zf-C4 ESR1_C
Other DBs
NCBI-GeneID: 24890
NCBI-ProteinID: NP_036821
RGD: 2581
Ensembl: ENSRNOG00000019358
Vega: OTTRNOG00000001366
UniProt: P06211
Position
1
AA seq 600 aa
MTMTLHTKASGMALLHQIQGNELEPLNRPQLKMPMERALGEVYVDNSKPAVFNYPEGAAY
EFNAAAAAAAAGASAPVYGQSSITYGPGSEAAAFGANSLGAFPQLNSVSPSPLMLLHPPP
HVSPFLHPHGHQVPYYLENEPSAYAVRDTGPPAFYRSNSDNRRQNGRERLSSSSEKGNMI
MESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRK
SCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDLEGRNEMGTSGDMRAANLWPSP
LVIKHTKKNSPALSLTADQMVSALLDAEPPLIYSEYDPSRPFSEASMMGLLTNLADRELV
HMINWAKRVPGFGDLNLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQG
KCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHI
HRVLDKINDTLIHLMAKAGLTLQQQHRRLAQLLLILSHIRHMSNKGMEHLYNMKCKNVVP
LYDLLLEMLDAHRLHAPASRMGVPPEEPSQSQLTTTSSTSAHSLQTYYIPPEAEGFPNTI
NT seq 1803 nt   +upstreamnt  +downstreamnt
atgaccatgacccttcacaccaaagcctcgggaatggccttgttgcaccagatccaaggg
aacgagctggagcccctcaatcgcccgcagctcaagatgcccatggagagggctctgggc
gaggtgtacgtggacaacagcaagcccgccgtgttcaactaccccgagggcgccgcctac
gagttcaacgccgccgccgccgccgcggccgccggggcctcggctccggtctatggccag
tcgagcatcacttacggtccggggtccgaggcggccgcctttggtgccaatagtctgggg
gctttcccccagctcaacagcgtgtcgcccagtccgctgatgctgctgcacccgccgccg
cacgtgtcgccgttcctgcacccgcatggccaccaggtgccctactacctggagaacgag
cccagcgcctacgctgtacgcgacaccggccctcccgccttctacaggtccaattctgac
aatcgacgccagaatggccgagagagactctccagcagcagcgagaagggaaacatgatc
atggagtctgccaaggagactcgctactgtgctgtgtgtaacgactatgcctctggctac
cattatggggtctggtcctgtgaaggctgcaaggctttctttaagagaagcattcaagga
cataatgactacatgtgtccagctacaaaccaatgcaccatcgataagaaccggaggaag
agttgccaggcctgccggctgcgcaagtgttacgaagtgggcatgatgaaaggcgggata
cgaaaagaccgccgaggagggagaatgttgaagcacaagcgtcagagagatgacttggaa
ggccgaaatgaaatgggcacttcaggagacatgagagctgccaacctttggccaagtcca
cttgtgatcaagcacactaagaagaatagccccgccctgtccttgacagctgaccagatg
gtcagtgccttattggatgctgaaccacctttgatctattctgaatatgatccttctaga
cccttcagtgaagcctcaatgatgggcttattgaccaacctggcagacagggagctggtt
catatgatcaactgggcaaagagagtgccaggctttggggacttgaatctccacgatcaa
gttcaccttctggagtgtgcctggttggagatcctgatgattggtctggtctggcgctcc
atggaacacccggggaagctcctgtttgctcctaacttgctcttggacaggaatcaaggt
aaatgtgtagaaggcatggtggagatctttgacatgttgctggctacgtcaagtcgattc
cgcatgatgaacctgcagggagaagagtttgtgtgcctcaaatcaatcattttgcttaat
tctggagtgtacacatttctatccagcaccttgaagtctctggaagagaaggaccacatc
caccgagtcctggacaagatcaacgacactttgatccacttgatggccaaagctggcctg
actctgcagcaacagcatcgccgtctggcccagctcctcctcatcctttcccatatccgg
cacatgagtaacaaaggcatggagcatctctacaacatgaaatgcaagaatgtcgtgcct
ctctatgacctgctgctggagatgctggatgctcatcgtcttcatgcccccgccagtcgc
atgggagtgcccccggaggagcctagccagagccagctgaccaccaccagctccacttca
gcacattccttacaaacctactacatccccccggaagcagagggcttccccaacaccatc
tga

KEGG   Rattus norvegicus (rat): 25149
Entry
25149             CDS       T01003                                 

Gene name
Esr2
Definition
(RefSeq) estrogen receptor beta
  KO
K08551  estrogen receptor beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04915  Estrogen signaling pathway
rno04917  Prolactin signaling pathway
rno04929  GnRH secretion
rno05200  Pathways in cancer
rno05207  Chemical carcinogenesis - receptor activation
rno05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    25149 (Esr2)
   04915 Estrogen signaling pathway
    25149 (Esr2)
   04917 Prolactin signaling pathway
    25149 (Esr2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25149 (Esr2)
   05207 Chemical carcinogenesis - receptor activation
    25149 (Esr2)
  09162 Cancer: specific types
   05224 Breast cancer
    25149 (Esr2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    25149 (Esr2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25149 (Esr2)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rno03310]
    25149 (Esr2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    25149 (Esr2)
Nuclear receptors [BR:rno03310]
 3. Estrogen like
  3A. Estrogen receptor
   25149 (Esr2)
SSDB
Motif
Pfam: ERbeta_N Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 25149
NCBI-ProteinID: NP_036886
RGD: 2582
Ensembl: ENSRNOG00000005343
Vega: OTTRNOG00000001373
UniProt: Q62986
Structure
PDB: 
1QKN 1HJ1 2J7X 2J7Y

Position
6
AA seq 485 aa
MTFYSPAVMNYSVPGSTSNLDGGPVRQSTSPNVLWPTSGHLSPLATHCQSSLLYAEPQKS
PWCEARSLEHTLPVNRETLKRKLSGSSCASPVTSPNAKRDAHFCAVCSDYASGYHYGVWS
CEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCG
YRIVRRQRSSSEQVHCLSKAKRNGGHAPRVKELLLSTLSPEQLVLTLLEAEPPNVLVSRP
SMPFTEASMMMSLTKLADKELVHMIGWAKKIPGFVELSLLDQVRLLESCWMEVLMVGLMW
RSIDHPGKLIFAPDLVLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMIL
LNSSMYPLASANQEAESSRKLTHLLNAVTDALVWVIAKSGISSQQQSVRLANLLMLLSHV
RHISNKGMEHLLSMKCKNVVPVYDLLLEMLNAHTLRGYKSSISGSECSSTEDSKNKESSQ
NLQSQ
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgacattctacagtcctgctgtgatgaactacagtgttcccggcagcaccagtaacctg
gacggtgggcctgtccgacagagcacaagcccaaatgtgctatggccaacttctgggcac
ctgtctcctttagcgacccattgccaatcatcgctcctctatgcagaacctcaaaagagt
ccttggtgtgaagcaagatcactagagcacaccttacctgtaaacagagagacactgaag
aggaagcttagtgggagcagttgtgccagccctgttactagtccaaacgcaaagagggat
gctcacttctgcgccgtctgcagcgattatgcatctgggtatcattacggcgtttggtca
tgtgaaggatgtaaggccttttttaaaagaagcattcaaggacataatgattatatctgt
ccagccacgaatcagtgtaccatagacaagaaccggcgtaaaagctgccaggcctgccga
cttcgcaagtgttatgaagtaggaatggtcaagtgtggatccaggagagaacggtgtggg
taccgtatagtgcggaggcagagaagttctagcgagcaggtacactgcctgagcaaagcc
aagagaaacggtgggcatgcaccccgggtgaaggagctactgctgagcaccttgagtcca
gagcaactggtgctcaccctcctggaagctgaaccacccaatgtgctggtgagccgtccc
agcatgcccttcaccgaggcctccatgatgatgtccctcactaagctggcggacaaggaa
ctggtgcacatgattggctgggccaagaaaatccctggctttgtggagctcagcctgttg
gaccaagtccggctcttagaaagctgctggatggaggtgctaatggtgggactgatgtgg
cgctccatcgaccaccccggcaagctcattttcgctcccgacctcgttctggacagggat
gaggggaagtgcgtagaagggattctggaaatctttgacatgctcctggcgacgacgtca
aggttccgtgagttaaaactccagcacaaggagtatctctgtgtgaaggccatgatcctc
ctcaactccagtatgtaccccttggcttctgcaaaccaggaggcagaaagtagccggaag
ctgacacacctactgaacgcggtgacagatgccctggtctgggtgattgcgaagagtggt
atctcctcccagcagcagtcagtccgactggccaacctcctgatgcttctttctcacgtc
aggcacatcagtaacaagggcatggaacatctgctcagcatgaagtgcaaaaatgtggtc
ccggtgtatgacctgctgctggagatgctgaatgctcacacgcttcgagggtacaagtcc
tcaatctcggggtctgagtgcagctcaacagaggacagtaagaacaaagagagctcccag
aacctacagtctcagtga

DBGET integrated database retrieval system