KEGG   Rattus norvegicus (rat): 24918
Entry
24918             CDS       T01003                                 

Gene name
Stat5a
Definition
(RefSeq) signal transducer and activator of transcription 5A
  KO
K11223  signal transducer and activator of transcription 5A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04012  ErbB signaling pathway
rno04217  Necroptosis
rno04630  JAK-STAT signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04917  Prolactin signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04935  Growth hormone synthesis, secretion and action
rno05161  Hepatitis B
rno05162  Measles
rno05166  Human T-cell leukemia virus 1 infection
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05207  Chemical carcinogenesis - receptor activation
rno05220  Chronic myeloid leukemia
rno05221  Acute myeloid leukemia
rno05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    24918 (Stat5a)
   04630 JAK-STAT signaling pathway
    24918 (Stat5a)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    24918 (Stat5a)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    24918 (Stat5a)
   04659 Th17 cell differentiation
    24918 (Stat5a)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    24918 (Stat5a)
   04935 Growth hormone synthesis, secretion and action
    24918 (Stat5a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24918 (Stat5a)
   05207 Chemical carcinogenesis - receptor activation
    24918 (Stat5a)
   05203 Viral carcinogenesis
    24918 (Stat5a)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    24918 (Stat5a)
   05220 Chronic myeloid leukemia
    24918 (Stat5a)
   05223 Non-small cell lung cancer
    24918 (Stat5a)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    24918 (Stat5a)
   05161 Hepatitis B
    24918 (Stat5a)
   05162 Measles
    24918 (Stat5a)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    24918 (Stat5a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    24918 (Stat5a)
Transcription factors [BR:rno03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    24918 (Stat5a)
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2 Flu_B_NS1
Other DBs
NCBI-GeneID: 24918
NCBI-ProteinID: NP_058760
RGD: 3773
Ensembl: ENSRNOG00000019496
UniProt: Q62771
Position
10
AA seq 793 aa
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRGQATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNCSSPAGVLVDAMSQKHLQINQTFEELRLITQDTESELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLNPQERMSRETALQQKQVSLETWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
SSNHLEDYNSMSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLKPFTTRDFSIRSLADRL
GDLNYLIYVFPDRPKDEVFAKYYTPVLAKAVDGYVKPQIKQVVPEFVNASADAGANATYM
DQAPSPVVCPQAHYNMYPPNPDPVLDQDGEFDLDETMDVARHVEELLRRPMDSLDPRLSP
PAGLFTSARSSLS
NT seq 2382 nt   +upstreamnt  +downstreamnt
atggcgggctggattcaggcccagcagctgcagggagacgctctgcgtcagatgcaagtg
ttatatgggcaacatttccccatcgaggtccggcactacctggcccagtggatcgagagc
cagccgtgggatgctattgacttggacaatccccaggaccgaggccaggccacccagctc
ctggagggcctggtgcaggagctgcagaagaaggcagaacaccaggtgggggaagatggc
tttttgctgaagatcaagctggggcactatgccacgcagctccagaacacgtacgaccgc
tgtcccatggagctggttcgctgtatccgtcacattctgtacaatgaacagaggctggtc
cgagaagccaacaattgcagctcccctgctggtgtcctggttgacgccatgtcccagaag
caccttcagatcaaccaaacgtttgaggagctgcgcctgatcacacaggacacggagagc
gagctgaagaagctgcagcagacccaagagtacttcatcatccagtaccaggagagcctg
cggatccaagctcagtttgcccagctggcccagctgaacccccaggagcgcatgagcagg
gagacagccctccagcagaagcaagtgtccctggagacctggctgcagcgagaggcacag
acactgcagcagtaccgcgtggagctggctgaaaagcaccagaagaccctgcagctgctg
aggaagcagcagaccatcatcctggacgacgagctgatccagtggaagcggcggcagcag
ctggccgggaacgggggtccccccgagggcagcctggacgtgctgcagtcctggtgtgag
aagctggccgagatcatctggcagaaccggcagcagatccgcagggctgagcacctgtgc
cagcagctgcccatccctggccccgtggaggagatgctggccgaggtcaacgccaccatc
acagacatcatctcagccctggtcaccagcacgttcatcatcgagaagcagcctcctcag
gtcctgaagacccagaccaagttcgcggccaccgtgcgcctgctggtgggcgggaagctg
aacgtgcacatgaaccctccgcaggtgaaggcgaccatcatcagcgagcagcaggccaag
tccctgctcaagaacgagaacacccgcaatgattacagtggcgagatcctgaacaactgc
tgcgtcatggagtaccaccaggccacaggcaccctcagtgcccacttcagaaacatgtca
ctgaaaagaatcaagcgtgctgacagacgcggtgccgagtctgtgacggaggagaagttc
acggtgctgtttgagtctcagttcagcgttggcagcaacgagctggtgttccaggtgaag
accctgtccctccctgtggtcgtcattgttcatggcagccaggaccacaatgctactgcc
accgtgctgtgggacaatgcctttgctgagccgggcagggtgccatttgccgtgcctgac
aaggtgctgtggccgcagctgtgtgaggcgctcaacatgaagttcaaggctgaggtgcag
agcaaccggggcttgaccaaggagaacctcgtgttcctggcacagaaactgttcaacagc
agcagcaaccacctcgaggactacaacagcatgtccgtgtcctggtcccagttcaaccgg
gagaacttgcccggctggaactataccttctggcagtggttcgacggggtgatggaggtg
ctgaagaagcatcataagccccactggaatgatggggccatcttgggtttcgtgaacaag
cagcaggcccatgacctgctcatcaacaagccagatgggacctttctgctgcgattcagc
gactcggaaatcgggggcatcaccattgcttggaagtttgactccccggaccgaaacctg
tggaatctgaagccattcaccactcgggatttctccattcggtccctggcggaccgcctg
ggggatctgaattacctcatctacgtgttcccagaccgacccaaggatgaggtctttgcc
aagtactacactcctgtacttgcaaaagcagtcgacggatacgtgaagccacagatcaag
caagtggtccctgagtttgtcaatgcttctgcagatgctggagccaacgccacctacatg
gaccaggctccttccccagtggtgtgccctcaggctcactacaacatgtacccaccgaac
cccgaccctgtccttgaccaagatggtgaatttgacctggatgagaccatggatgttgcc
aggcatgtggaggaacttttacgccggcccatggacagtcttgacccccgcctttcccca
cctgctggcctcttcacttctgccagaagctccttgtcctga

KEGG   Rattus norvegicus (rat): 25125
Entry
25125             CDS       T01003                                 

Gene name
Stat3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04062  Chemokine signaling pathway
rno04066  HIF-1 signaling pathway
rno04068  FoxO signaling pathway
rno04217  Necroptosis
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04630  JAK-STAT signaling pathway
rno04659  Th17 cell differentiation
rno04917  Prolactin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04931  Insulin resistance
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04935  Growth hormone synthesis, secretion and action
rno05145  Toxoplasmosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05207  Chemical carcinogenesis - receptor activation
rno05212  Pancreatic cancer
rno05221  Acute myeloid leukemia
rno05223  Non-small cell lung cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05321  Inflammatory bowel disease
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    25125 (Stat3)
   04066 HIF-1 signaling pathway
    25125 (Stat3)
   04068 FoxO signaling pathway
    25125 (Stat3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    25125 (Stat3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    25125 (Stat3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    25125 (Stat3)
   04062 Chemokine signaling pathway
    25125 (Stat3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    25125 (Stat3)
   04917 Prolactin signaling pathway
    25125 (Stat3)
   04935 Growth hormone synthesis, secretion and action
    25125 (Stat3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25125 (Stat3)
   05206 MicroRNAs in cancer
    25125 (Stat3)
   05205 Proteoglycans in cancer
    25125 (Stat3)
   05207 Chemical carcinogenesis - receptor activation
    25125 (Stat3)
   05203 Viral carcinogenesis
    25125 (Stat3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    25125 (Stat3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    25125 (Stat3)
   05221 Acute myeloid leukemia
    25125 (Stat3)
   05223 Non-small cell lung cancer
    25125 (Stat3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    25125 (Stat3)
   05160 Hepatitis C
    25125 (Stat3)
   05171 Coronavirus disease - COVID-19
    25125 (Stat3)
   05162 Measles
    25125 (Stat3)
   05163 Human cytomegalovirus infection
    25125 (Stat3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    25125 (Stat3)
   05169 Epstein-Barr virus infection
    25125 (Stat3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    25125 (Stat3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    25125 (Stat3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    25125 (Stat3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    25125 (Stat3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    25125 (Stat3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    25125 (Stat3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25125 (Stat3)
Transcription factors [BR:rno03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    25125 (Stat3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 E2R135 Syntaxin-6_N DUF4795 Fib_alpha
Other DBs
NCBI-GeneID: 25125
NCBI-ProteinID: NP_036879
RGD: 3772
Ensembl: ENSRNOG00000019742
UniProt: P52631
Position
10
AA seq 770 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVDLFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMDLTSECATSPM
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggctcagtggaaccagctccagcagctggacacgcgctacctggagcagcttcatcag
ctgtacagcgatagcttccccatggagctgcggcagttcctggcgccttggattgagagc
caagattgggcatatgcagccagcaaagagtcacacgccactctggtgtttcataacctc
ttgggcgagatcgaccagcagtatagccgattcctgcaggagtccaatgtcctctatcag
cacaacctgcgaagaatcaagcagttcctgcagagcaggtatcttgagaagccaatggaa
attgcccggattgtggcccgatgcctgtgggaagagtctcgcctcctccagacggcagcc
acggcagcccagcaagggggccaggccaaccaccccacagctgccgtagtgacggagaag
cagcagatgctggaacagcatcttcaggatgtccggaagcgtgtgcaggatctagaacag
aaaatgaaagtggtggagaatctccaggatgactttgatttcaactataaaaccctcaag
agtcaaggagacatgcaggatctgaatggaaacaaccagtctgtgaccagacagaagatg
cagcagctggagcagatgctcacggccctggaccagatgcggaggagcatcgtgagcgag
ctggcagggctcttgtcagcaatggagtacgtgcagaagacactgaccgatgaagagctg
gctgactggaagaggcggcagcagatagcgtgcatcggaggccctcccaacatctgcctg
gaccgtctggaaaactggataacttcattagcagaatctcaacttcagacccgccaacaa
attaagaaactggaggagctgcagcagaaagtgtcctacaagggggaccctattgtgcag
caccggccaatgctggaggagaggatcgtggatctgttcagaaacttaatgaagagtgcc
ttcgtggtggagcggcagccctgtatgcccatgcacccggaccggcccttagtcatcaag
actggtgtccagtttaccacaaaagtcaggttgctggtcaaatttcctgagttgaattat
cagcttaaaattaaagtgtgcattgataaggactctggggatgttgctgccctcagaggg
tctcggaaatttaacattctgggcacgaacacaaaggtgatgaacatggaggagtccaac
aacggcagcctgtctgcagagttcaagcacctgaccctgagggagcagagatgtgggaat
gggggccgtgccaattgtgatgcctccttgattgtcactgaggagctgcacctgatcacc
tttgagacagaggtgtaccaccaaggtctcaagatcgacctagagacccactccttgcca
gtcgtggtgatctccaacatctgtcagatgcctaatgcttgggcatcaatcctgtggtat
aacatgctgaccaataaccccaagaacgtgaacttcttcactaagcctccgattggaacc
tgggaccaagtggccgaggtgctgagctggcagttctcgtccaccaccaagcgagggctg
agcatcgagcagctgaccacgctggccgagaagctcttagggcctggtgtgaactactca
gggtgtcagatcacatgggctaagttttgcaaagaaaacatggccggcaagggcttctcg
ttctgggtctggctagacaatatcatcgaccttgtgaaaaagtatatcttggccctttgg
aatgaagggtacatcatgggtttcatcagcaaggagcgggagagggccatcctaagcaca
aagcccccgggcaccttcctgctgcggttcagtgagagcagcaaggaaggaggggtcact
ttcacttgggtggaaaaggacatcagtggcaagacccagatccagtctgtagaaccatat
accaagcagcagctgaacaacatgtcatttgctgaaatcatcatgggctataagatcatg
gacgctaccaacatcctggtatccccactggtctacctctaccctgacattcccaaggag
gaggcattcggaaagtattgtcgccccgagagccaggagcaccctgaagctgacccaggt
agtgctgccccttacctgaagaccaagttcatctgtgtgacaccaacgacctgcagcaat
accattgacctgccgatgtccccccgcactttagattcattgatgcagtttggaaataac
ggggaaggcgctgagccctcagcaggagggcagtttgagtcgctcacgtttgacatggat
ctgacctcggagtgtgctacctccccgatgtga

KEGG   Rattus norvegicus (rat): 25126
Entry
25126             CDS       T01003                                 

Gene name
Stat5b
Definition
(RefSeq) signal transducer and activator of transcription 5B
  KO
K11224  signal transducer and activator of transcription 5B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04012  ErbB signaling pathway
rno04062  Chemokine signaling pathway
rno04217  Necroptosis
rno04630  JAK-STAT signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04917  Prolactin signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04935  Growth hormone synthesis, secretion and action
rno05161  Hepatitis B
rno05162  Measles
rno05166  Human T-cell leukemia virus 1 infection
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05207  Chemical carcinogenesis - receptor activation
rno05220  Chronic myeloid leukemia
rno05221  Acute myeloid leukemia
rno05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    25126 (Stat5b)
   04630 JAK-STAT signaling pathway
    25126 (Stat5b)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    25126 (Stat5b)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    25126 (Stat5b)
   04659 Th17 cell differentiation
    25126 (Stat5b)
   04062 Chemokine signaling pathway
    25126 (Stat5b)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    25126 (Stat5b)
   04935 Growth hormone synthesis, secretion and action
    25126 (Stat5b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25126 (Stat5b)
   05207 Chemical carcinogenesis - receptor activation
    25126 (Stat5b)
   05203 Viral carcinogenesis
    25126 (Stat5b)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    25126 (Stat5b)
   05220 Chronic myeloid leukemia
    25126 (Stat5b)
   05223 Non-small cell lung cancer
    25126 (Stat5b)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    25126 (Stat5b)
   05161 Hepatitis B
    25126 (Stat5b)
   05162 Measles
    25126 (Stat5b)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    25126 (Stat5b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25126 (Stat5b)
Transcription factors [BR:rno03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    25126 (Stat5b)
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 25126
NCBI-ProteinID: NP_071775
RGD: 3774
Ensembl: ENSRNOG00000019075
UniProt: P52632 A0A0G2JSR4
Position
10
AA seq 786 aa
MAMWIQAQQLQGDALHQMQALYGQHFPIEVRHYLSQWIESQAWDSIDLDNPQENIKATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGSSPAGSLADAMSQKHLQINQTFEELRLITQDTESELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLNPQERMSRETALQQKQVSLETWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTILFDSQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
SSNHLEDYNSMSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL
GDLNYLIYVFPDRPKDEVYSKYYTPVPCEPATAKAADGYVKPQIKQVVPEFVNASADAGS
GATYMDQAPSPVVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQW
IPHAQS
NT seq 2361 nt   +upstreamnt  +downstreamnt
atggcaatgtggatacaggctcagcagctccagggcgatgcccttcatcagatgcaggcc
ttgtacggccagcatttccccatcgaggtgcgacattatttatcccagtggatcgaaagt
caagcctgggactcaatagatcttgataatccacaggagaacattaaggccacccagctc
ctggagggcctggtgcaggagctgcagaagaaggcagaacaccaggtgggggaagatggg
tttttgctgaagatcaagctggggcactatgccacgcagctccagaacacgtatgaccgc
tgccccatggagctggttcgctgtatccggcacattctatacaatgaacagaggctggtc
cgagaagccaacaacggaagctctccggctggaagtcttgctgacgccatgtcccagaag
caccttcagatcaaccaaacgtttgaggagctgcgtctgatcacacaggacacggagagc
gagctgaagaagctgcagcagacccaagagtacttcatcatccagtaccaggagagccta
cggatccaagctcagtttgcccagctggcccaactgaacccccaggagcgcatgagcagg
gagacagccctccagcagaagcaagtgtccctggagacctggctgcagcgagaggcacag
acactgcagcagtaccgcgtggagctggctgaaaagcaccagaagaccctgcagctgctg
aggaagcagcagaccatcatcctggacgacgagctgatccagtggaagcggcgacagcaa
ctggccgggaatgggggtcctcctgagggcagcctggatgtgctgcagtcctggtgtgag
aagctggccgagatcatctggcagaaccggcagcagatccgcagggctgagcacctgtgc
cagcagctgcccatcccaggccccgtggaggagatgctggccgaggtcaacgccaccatc
acagacatcatctcagccctggtcaccagcacgttcatcatcgagaagcagcctcctcag
gtcctgaagacccagaccaagttcgcggccaccgtgcgcctgctggtgggcgggaagctg
aacgtgcacatgaaccctccgcaggtgaaggcaaccatcatcagcgagcagcaggccaag
tccctgctcaagaacgagaacacccgcaatgattatagcggcgagatcctgaacaactgc
tgcgtcatggagtaccaccaggccacaggcaccctcagcgcccacttcagaaacatgtcc
ctgaaacgaatcaagaggtctgaccgccgtggtgcagagtcggtcacggaagagaagttc
acaatcttgtttgactcacagttcagtgttggtggaaatgagctggtctttcaagtcaag
accttgtcgctcccggtggtggtgatcgttcacggcagccaggacaacaatgcgacggct
accgtcctctgggacaacgcctttgcagagcctggcagggtgccatttgccgtgcctgac
aaggtgctgtggccgcagctgtgtgaggcgctcaacatgaagttcaaggctgaggtgcag
agcaaccggggcttgaccaaggagaacctcgtgttcctggcacagaaactgttcaacagc
agcagcaaccacctcgaggactacaacagcatgtccgtgtcctggtcccagttcaaccgg
gagaatctgccaggacggaattacactttctggcagtggtttgacggtgtgatggaggtg
ttaaagaaacatctcaagcctcactggaacgatggggccatcttgggtttcgtgaacaag
cagcaggcccacgacctgctcatcaacaagccagatgggaccttcctgctgcgcttcagc
gactcggaaatcgggggcatcaccattgcttggaagtttgactcccaggagagaatgttt
tggaatctgatgccttttaccacaagagacttctctatccggtccctcgctgaccgcctg
ggggacctgaattacctcatatacgtgtttcctgatcggccaaaggatgaagtatattct
aagtactacacaccagtcccgtgtgagcccgccaccgcgaaagcagctgacggatacgtg
aagccgcagatcaagcaagtggtccccgagtttgtcaatgcttctgcagatgcagggagc
ggcgccacctacatggaccaggctccttccccagtggtgtgccctcaggctcactataac
atgtacccacagaatcccgactctgtcctcgataccgatggggatttcgatctggaagac
acgatggacgtggcacggcgtgtggaagagctcttaggccggcccatggacagtcagtgg
atccctcacgcgcagtcatga

DBGET integrated database retrieval system