KEGG   Rattus norvegicus (rat): 25271
Entry
25271             CDS       T01003                                 

Gene name
Rxra
Definition
(RefSeq) retinoic acid receptor RXR-alpha
  KO
K08524  retinoid X receptor alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03320  PPAR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04659  Th17 cell differentiation
rno04919  Thyroid hormone signaling pathway
rno04920  Adipocytokine signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno04932  Non-alcoholic fatty liver disease
rno04976  Bile secretion
rno05160  Hepatitis C
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05207  Chemical carcinogenesis - receptor activation
rno05216  Thyroid cancer
rno05222  Small cell lung cancer
rno05223  Non-small cell lung cancer
rno05226  Gastric cancer
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    25271 (Rxra)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    25271 (Rxra)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    25271 (Rxra)
   03320 PPAR signaling pathway
    25271 (Rxra)
   04919 Thyroid hormone signaling pathway
    25271 (Rxra)
   04928 Parathyroid hormone synthesis, secretion and action
    25271 (Rxra)
  09154 Digestive system
   04976 Bile secretion
    25271 (Rxra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25271 (Rxra)
   05202 Transcriptional misregulation in cancer
    25271 (Rxra)
   05207 Chemical carcinogenesis - receptor activation
    25271 (Rxra)
  09162 Cancer: specific types
   05226 Gastric cancer
    25271 (Rxra)
   05216 Thyroid cancer
    25271 (Rxra)
   05222 Small cell lung cancer
    25271 (Rxra)
   05223 Non-small cell lung cancer
    25271 (Rxra)
  09172 Infectious disease: viral
   05160 Hepatitis C
    25271 (Rxra)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    25271 (Rxra)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    25271 (Rxra)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    25271 (Rxra)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rno03310]
    25271 (Rxra)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    25271 (Rxra)
Nuclear receptors [BR:rno03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   25271 (Rxra)
SSDB
Motif
Pfam: Nuc_recep-AF1 Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 25271
NCBI-ProteinID: NP_036937
RGD: 3610
Ensembl: ENSRNOG00000009446
UniProt: Q0VJ96
Position
3
AA seq 467 aa
MDTKHFLPLDFSTQVNSSSLSSPTGRGSMAAPSLHPSLGPGLGSPLGSPGQLHSPISTLS
SPINGMGPPFSVISSPMGPHSMSVPTTPTLGFGTGSPQLNSPMNPVSSSEDIKPPLGLNG
VLKVPAHPSGNMSSFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNK
DCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVEKI
LEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLD
DQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVS
KMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRF
AKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQTT
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggacaccaaacatttcctgccgctcgacttctctacccaggtgaactcttcatccctg
agctctccaacgggtcgaggctccatggctgccccctcgctgcacccttccctgggtcca
ggactcggctctcctctgggctcccctgggcagctgcactcgcctatcagcaccctgagt
tctcccatcaatggcatgggcccacccttctcggtcatcagctccccgatgggcccgcac
tccatgtcggtacccaccacacccacactgggcttcgggactggcagcccccagctcaac
tcacccatgaaccccgtgagcagcagtgaggatatcaaaccccctctaggcctcaatggc
gtcctcaaggttcctgcccacccctcaggaaatatgtcatccttcaccaagcacatctgc
gctatctgtggggaccgctcctcaggcaaacactatggggtctacagctgtgagggctgc
aagggcttcttcaagaggacagtacgcaaagacctgacctacacctgccgtgacaacaag
gactgcctgatcgacaagagacagcggaaccggtgtcagtactgccgataccagaagtgc
ctggccatgggcatgaagcgggaagccgtgcaggaggagcggcagcgaggcaaggaccgg
aacgagaatgaggtggagtccaccagcagtgccaacgaggacatgcctgtagagaagatt
ctggaagctgagctcgctgttgagcccaagactgagacatacgtggaggcaaacatgggg
ctgaaccccagctcaccaaatgaccctgttaccaacatctgtcaagcagcagacaagcag
ctcttcactcttgtggagtgggccaagaggatcccacacttttctgagctgcccctggac
gaccaggtcatcctcctccgggcaggctggaacgagctgctgattgcctccttctcccac
cgctccatagctgtgaaagacggcatcctcctggccaccggcctgcacgtacacaggaac
agcgctcacagtgctggggtgggcgccatctttgacagggtgctaacggagctggtgtcg
aagatgcgtgacatgcagatggacaagacggagctgggctgcttgcgcgccattgtcctc
ttcaaccctgactctaaggggctctcaaaccctgctgaggtggaggcgctgagggagaag
gtgtatgcatcactagaagcgtactgcaaacacaagtaccctgagcagccgggcaggttt
gccaagctgctgctccggctgcctgcactgcgatccattgggctcaagtgcctggagcac
ctgttcttcttcaagctcatcggggatacacccatcgacactttcctcatggagatgctg
gaggccccacatcaaaccacctag

DBGET integrated database retrieval system