KEGG   Rattus norvegicus (rat): 25408
Entry
25408             CDS       T01003                                 

Symbol
Cd80
Name
(RefSeq) T-lymphocyte activation antigen CD80
  KO
K05412  CD80 antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules
rno04620  Toll-like receptor signaling pathway
rno04672  Intestinal immune network for IgA production
rno04940  Type I diabetes mellitus
rno05320  Autoimmune thyroid disease
rno05322  Systemic lupus erythematosus
rno05323  Rheumatoid arthritis
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    25408 (Cd80)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    25408 (Cd80)
   04672 Intestinal immune network for IgA production
    25408 (Cd80)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    25408 (Cd80)
   05323 Rheumatoid arthritis
    25408 (Cd80)
   05320 Autoimmune thyroid disease
    25408 (Cd80)
   05330 Allograft rejection
    25408 (Cd80)
   05332 Graft-versus-host disease
    25408 (Cd80)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    25408 (Cd80)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    25408 (Cd80)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    25408 (Cd80)
CD molecules [BR:rno04090]
 Proteins
  25408 (Cd80)
SSDB
Motif
Pfam: C2-set_2 Ig_3 I-set V-set C1-set ig Ig_2 CD20
Other DBs
NCBI-GeneID: 25408
NCBI-ProteinID: NP_037058
RGD: 2314
Ensembl: ENSRNOG00000001527
UniProt: O35187
Position
11
AA seq 321 aa
MAYSCQLMQESPLLGFPRLRFIHLFVLLLVGLFQISSGIVGQVSKSVREKALLSCDYKFC
SEEQSIHRIYWQKHDKMVLSVISGVPEVWPEYKNRTVYDIANNYSFSLLGLILSDRGTYT
CVVQRYEGGSYVVKHLTTVELSVRADFPTPNITESGNPSADIKRITCFASGGFPKPRLSW
LENGRELNGINTTISQDPESELYTISSQLDFNTTYDHFIDCFIEYGDAHVSQNFTWEKPP
EDPPDEKQTIPFAWAGSDAVKAIIIFFIAITVIAVIAAIAIIIFCITVKFRRCFRRRNEA
SRETNKNLYIGPVEAAAEQTV
NT seq 966 nt   +upstreamnt  +downstreamnt
atggcttacagttgccagctgatgcaggaatcaccactcctcgggtttccacgtctcagg
ttcattcatctctttgtgctgctgctggttggtcttttccagatatcttcaggtattgtc
ggccaagtgtccaagtcggtgagagaaaaggcattgctgtcctgtgattacaaattttgt
tctgaagagcagtccatacaccgaatctactggcaaaaacatgacaaaatggtgctctct
gtcatctccggggtaccggaagtgtggcccgagtacaagaaccggactgtatacgacatc
gctaacaactactcctttagcctcctgggcctgatcctttcagacaggggcacatacacc
tgtgtcgttcaaaggtacgaaggaggatcgtacgtggtgaaacacctgaccaccgtggag
ctgtctgtcagagctgacttccctacccccaacataactgagtctggaaatccatctgct
gacataaagaggattacctgctttgcttccgggggtttcccaaagcctcgcctctcttgg
ttggaaaatggaagagaattaaatggcatcaatacaacaatttcccaggatcctgaatct
gagctgtacaccattagtagccaactagacttcaacacgacgtacgaccacttcatcgat
tgtttcattgagtatggagatgctcacgtgtcacagaacttcacctgggaaaaaccccca
gaagaccctcctgatgaaaagcaaacaattccgtttgcctgggcaggatctgatgcagtc
aaagccatcatcatcttcttcatcgccatcaccgtcatcgccgtcatcgccgccatcgcc
atcatcatcttctgcatcactgtcaaattccgacgctgcttcagaagaagaaatgaggca
agcagagaaacaaacaagaacctctacatagggcctgtggaagcagcagctgaacagact
gtttga

KEGG   Rattus norvegicus (rat): 56822
Entry
56822             CDS       T01003                                 

Symbol
Cd86
Name
(RefSeq) T-lymphocyte activation antigen CD86 precursor
  KO
K05413  CD86 antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules
rno04620  Toll-like receptor signaling pathway
rno04672  Intestinal immune network for IgA production
rno04940  Type I diabetes mellitus
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05202  Transcriptional misregulation in cancer
rno05320  Autoimmune thyroid disease
rno05322  Systemic lupus erythematosus
rno05323  Rheumatoid arthritis
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    56822 (Cd86)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    56822 (Cd86)
   04672 Intestinal immune network for IgA production
    56822 (Cd86)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    56822 (Cd86)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    56822 (Cd86)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    56822 (Cd86)
   05323 Rheumatoid arthritis
    56822 (Cd86)
   05320 Autoimmune thyroid disease
    56822 (Cd86)
   05330 Allograft rejection
    56822 (Cd86)
   05332 Graft-versus-host disease
    56822 (Cd86)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    56822 (Cd86)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    56822 (Cd86)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    56822 (Cd86)
   04090 CD molecules [BR:rno04090]
    56822 (Cd86)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   56822 (Cd86)
CD molecules [BR:rno04090]
 Proteins
  56822 (Cd86)
SSDB
Motif
Pfam: V-set Ig_3 C2-set_2 V-set_CD47 I-set Ig_6 PCYCGC
Other DBs
NCBI-GeneID: 56822
NCBI-ProteinID: NP_064466
RGD: 628714
Ensembl: ENSRNOG00000038835
UniProt: O35531
Position
11
AA seq 313 aa
MYVVKTCVTCTMYLGILFSVLAYLLSDAVPVKRQAYFNSTAYLPCPFTKAQNISPSELVV
FWQDRKKSVLYEHYLGAEKLDNVNAKYLGRTSFDRDNQALRLHNVQIKDTGLYDCFIQQK
TPTGSIILQQWETELSVIANFSEPEIEEAQNETRNTGINLTCSSKQGYPKPTKMYFLITN
STNEYGDNMQISQDNVTKLFSVSISLSLPFPDGVYNMTIVCILETESMNISSKPHNMVFS
QPQFDRKTWIQIAGPSSLLCCLFLLVVYKAVKKCLKMQNQPGRPSRKTCESKQDSGVDES
INLEEVEPQLHQQ
NT seq 942 nt   +upstreamnt  +downstreamnt
atgtatgtcgtcaagacatgtgtaacctgcaccatgtacttgggaatccttttctcggtg
ttggcctatctgctctcagatgctgttcctgtgaagaggcaagcttacttcaatagcact
gcatacctgccgtgcccgttcacaaaggctcaaaacataagcccgagtgagctcgtagta
ttttggcaggaccggaaaaagtcggttctgtacgaacactatttgggcgcagagaaactt
gataacgtgaatgccaagtacctgggccgcacaagctttgatagggataaccaggctcta
cgacttcacaatgttcagatcaaggacacgggcttgtatgattgttttatacagcaaaag
acacccacgggatcaattatcctccagcagtgggaaacagagctctcagtgatcgccaac
ttcagtgaacctgaaatagaggaggctcagaatgaaacaagaaacactggcataaatttg
acctgctcatctaagcaaggatacccgaaacctacaaagatgtattttttgataactaat
tcaactaatgagtatggcgacaacatgcagatatcacaagacaatgtcacaaagctgttc
agtgtctccatcagcctatctcttccattcccggatggggtgtacaatatgaccattgtg
tgtattctggaaacggagtcaatgaatatttcctccaaacctcacaatatggttttttcg
cagccccagtttgatcgaaagacttggatccagattgcaggtcccagttcacttctgtgc
tgtctctttctgctggtcgtctacaaagcagtcaaaaagtgtttgaagatgcagaaccag
cccggcagacccagcagaaagacttgtgagtccaagcaggacagtggtgttgacgagtcg
atcaacctggaggaagttgaaccccaattgcatcagcagtaa

DBGET integrated database retrieval system