KEGG   Rattus norvegicus (rat): 25449
Entry
25449             CDS       T01003                                 

Gene name
Fshr
Definition
(RefSeq) follicle-stimulating hormone receptor precursor
  KO
K04247  follicle stimulating hormone receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    25449 (Fshr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25449 (Fshr)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    25449 (Fshr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    25449 (Fshr)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Follicle stimulating hormone (FSH)
    25449 (Fshr)
Motif
Pfam: 7tm_1 GnHR_trans LRR_8 LRR_5 LRRNT LRR_4 LRR_9
Other DBs
NCBI-GeneID: 25449
NCBI-ProteinID: NP_954707
RGD: 2632
Ensembl: ENSRNOG00000016783
UniProt: P20395
Position
6
AA seq 692 aa
MALLLVSLLAFLGTGSGCHHWLCHCSNRVFLCQDSKVTEIPTDLPRNAIELRFVLTKLRV
IPKGSFAGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLP
SLRYLLISNTGIKHLPAVHKIQSLQKVLLDIQDNINIHIVARNSFMGLSFESVILWLSKN
GIEEIHNCAFNGTQLDELNLSDNNNLEELPNDVFQGASGPVILDISRTKVHSLPNHGLEN
LKKLRARSTYRLKKLPNLDKFVTLMEASLTYPSHCCAFANLKRQISELHPICNKSILRQD
IDDMTQIGDQRVSLIDDEPSYGKGSDMMYNEFDYDLCNEVVDVTCSPKPDAFNPCEDIMG
YNILRVLIWFISILAITGNTTVLVVLTTSQYKLTVPRFLMCNLAFADLCIGIYLLLIASV
DIHTKSQYHNYAIDWQTGAGCDAAGFFTVFASELSVYTLTAITLERWHTITHAMQLECKV
QLRHAASVMVLGWTFAFAAALFPIFGISSYMKVSICLPMDIDSPLSQLYVMALLVLNVLA
FVVICGCYTHIYLTVRNPTIVSSSSDTKIAKRMATLIFTDFLCMAPISFFAISASLKVPL
ITVSKAKILLVLFYPINSCANPFLYAIFTKNFRRDFFILLSKFGCYEMQAQIYRTETSSA
THNFHARKSHCSSAPRVTNSYVLVPLNHSSQN
NT seq 2079 nt   +upstreamnt  +downstreamnt
atggccttgctcctggtctccttgctggcattcttgggcacgggatctggatgtcatcac
tggctgtgtcattgctctaatagggtctttctctgccaagacagcaaggtgacagagatt
ccgaccgacctcccccggaacgccattgaactgaggtttgtgctcaccaagcttcgagtc
atcccgaaaggatcatttgctggatttggagacctggagaaaatagagatctctcagaat
gatgtcttggaagtaatagaggcagatgtgttctccaacctacccaagttgcatgaaatt
aggattgaaaaggccaacaatcttctgtacatcaacccggaggccttccagaatctcccc
agtctcagatatctgttaatatccaacacaggcattaagcacttgccagctgttcacaag
atccagtctctccaaaaggttctactagacattcaagataacataaacatccacatcgtt
gccaggaactccttcatgggactgagttttgaaagtgtgattttatggctgagtaagaat
gggattgaagaaatacacaactgtgcattcaacggaactcagctagatgaactgaatcta
agcgataacaataatttggaagaattgcctaatgacgttttccagggagcctctgggcca
gtcattttagatatctcaaggacaaaggtccattccttaccaaaccatggcttagaaaat
ctgaagaagctgagggccaggtcaacataccgcttgaaaaagctccctaatctggacaag
tttgtcaccctcatggaggccagcctcacctaccccagccactgctgtgcttttgcaaac
ttgaagcggcaaatctctgaacttcatccaatttgcaacaagtctattttaaggcaagat
attgatgatatgactcaaattggggatcagagagtctctctgatagatgatgaacccagt
tatggaaaaggatctgacatgatgtacaatgaatttgattatgacttatgtaatgaagtt
gttgatgtgacctgctcaccaaagccagatgcatttaatccatgtgaagatatcatgggg
tacaacatcctcagggtcttgatatggtttattagcatcctggccattactgggaacacc
acagtgctggtggtcctgaccacaagccaatacaaactaactgtgccccggtttcttatg
tgtaacctcgccttcgctgatctctgcataggcatctacttgctacttatagcatcagtt
gacatccataccaagagccagtaccacaactatgccattgactggcaaacaggagcaggc
tgtgatgctgctggctttttcactgtctttgccagtgaactgtcagtctacacattgaca
gccatcaccctagaaagatggcataccatcacacatgctatgcaactggaatgcaaggtg
cagctccggcatgctgccagcgtcatggtattgggctggacttttgccttcgcagctgct
ctcttccccatctttggcatcagtagctacatgaaagtgagcatctgcctgcccatggat
atcgacagccctttgtcacagctgtatgttatggccctccttgtcctcaatgtcctggcc
tttgtggtcatctgtggctgctatacccacatctacctcacagtgaggaatcctaccatt
gtgtcctcatcaagcgacaccaagattgccaagcgcatggccacactcatcttcacagac
tttctctgcatggcccccatttcattctttgccatttctgcctccctcaaggtgccgctc
atcactgtgtccaaggccaagattctcctagttctgttctaccccatcaattcttgtgcc
aatcctttcctctacgccattttcaccaagaacttccgcagggacttcttcatcctgctg
agcaagtttggctgttatgaaatgcaagcccagatttacaggacagaaacctcatccgct
acccacaacttccatgcccgaaagagccactgctcctcagctcccagagtcaccaatagt
tacgtgcttgtccctcttaatcattcatcccagaactaa

DBGET integrated database retrieval system