KEGG   Rattus norvegicus (rat): 25576
Entry
25576             CDS       T01003                                 

Gene name
Ywhah
Definition
(RefSeq) 14-3-3 protein eta
  KO
K16198  14-3-3 protein gamma/eta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04151  PI3K-Akt signaling pathway
rno04390  Hippo signaling pathway
rno05160  Hepatitis C
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    25576 (Ywhah)
   04151 PI3K-Akt signaling pathway
    25576 (Ywhah)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    25576 (Ywhah)
   04114 Oocyte meiosis
    25576 (Ywhah)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    25576 (Ywhah)
  09172 Infectious disease: viral
   05160 Hepatitis C
    25576 (Ywhah)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    25576 (Ywhah)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    25576 (Ywhah)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25576 (Ywhah)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     25576 (Ywhah)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    25576 (Ywhah)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   25576 (Ywhah)
SSDB
Motif
Pfam: 14-3-3 CodY
Other DBs
NCBI-GeneID: 25576
NCBI-ProteinID: NP_037184
RGD: 3978
Ensembl: ENSRNOG00000055471
UniProt: P68511
Position
14
AA seq 246 aa
MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSW
RVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLALLDKFLIKNCNDFQYESK
VFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEHMQPTHPIRLGLALNFS
VFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDE
EAGEGN
NT seq 741 nt   +upstreamnt  +downstreamnt
atgggggaccgagagcagctgctgcagcgggcgcgactggcggagcaggcggagcgctac
gacgacatggcctccgccatgaaggcggtgacagagctgaatgaacctctatctaatgaa
gatagaaatctcctctctgtggcctacaagaatgtagttggtgccaggcgatcttcttgg
agggttattagtagcattgagcagaaaaccatggcagatgggaatgagaagaagctggag
aaagtcaaagcctatcgggagaagattgagaaggagctggagacagtttgcaatgatgtc
ttggctctgctcgacaagttccttatcaagaactgcaatgattttcagtacgagagcaag
gtgttctacctgaaaatgaagggcgattactaccgctacctggcagaggtggcttctggg
gagaagaaaaacagtgtggttgaagcttctgaggcagcgtataaggaagccttcgaaatc
agcaaagagcacatgcagccaacacaccccatccggcttggcctggccctcaatttttct
gtgttctactatgagatccagaatgcaccagagcaggcctgcctcttagccaaacaagcc
ttcgatgatgctatagctgagctggacacattaaacgaggattcctataaggactccact
ctcatcatgcagttgctgcgagacaacctcaccctctggacgagcgaccagcaggatgaa
gaagccggagaaggcaactga

KEGG   Rattus norvegicus (rat): 25577
Entry
25577             CDS       T01003                                 

Gene name
Ywhaq
Definition
(RefSeq) 14-3-3 protein theta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04151  PI3K-Akt signaling pathway
rno04390  Hippo signaling pathway
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    25577 (Ywhaq)
   04151 PI3K-Akt signaling pathway
    25577 (Ywhaq)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    25577 (Ywhaq)
   04114 Oocyte meiosis
    25577 (Ywhaq)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    25577 (Ywhaq)
  09172 Infectious disease: viral
   05161 Hepatitis B
    25577 (Ywhaq)
   05160 Hepatitis C
    25577 (Ywhaq)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    25577 (Ywhaq)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25577 (Ywhaq)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    25577 (Ywhaq)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   25577 (Ywhaq)
SSDB
Motif
Pfam: 14-3-3 FliM
Other DBs
NCBI-GeneID: 25577
NCBI-ProteinID: NP_037185
RGD: 3979
Ensembl: ENSRNOG00000051650
UniProt: P68255
Position
6
AA seq 245 aa
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWR
VISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLK
MKGDYFRYLAEVACGDDRKQTIENSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYE
ILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAA
EGAEN
NT seq 738 nt   +upstreamnt  +downstreamnt
atggagaagaccgagctgatccagaaggccaagctggccgagcaggccgagcgctacgac
gacatggccacctgcatgaaagccgtgacggagcagggcgccgagctgtccaacgaggag
cgcaacctgctatctgtggcctacaagaacgtggtcgggggccgcaggtccgcctggagg
gtcatctcgagcattgagcagaagaccgatacctcggacaagaagttgcagctgatcaag
gactatcgggagaaagtggagtctgagctgaggtccatctgcaccacggtcctggaattg
ttggataagtatttaatagccaatgcaactaatccagagagtaaggtcttctatctgaaa
atgaagggagattatttccggtatcttgctgaagtcgcttgtggtgatgatcgaaaacaa
acgatagaaaattcccaaggagcctaccaagaggcatttgatataagcaagaaagagatg
caacctacacatccgatccgcctggggctggctcttaacttttctgtattttactatgag
atccttaataatcccgagcttgcctgcacactggctaaaacggcttttgatgaagccatc
gccgagcttgatacactgaatgaagactcctacaaagacagcaccctcatcatgcagttg
cttagagacaacttaacattatggacatcagacagtgcaggagaagaatgtgatgcagct
gagggggctgagaactaa

KEGG   Rattus norvegicus (rat): 25578
Entry
25578             CDS       T01003                                 

Gene name
Ywhaz
Definition
(RefSeq) 14-3-3 protein zeta/delta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04151  PI3K-Akt signaling pathway
rno04390  Hippo signaling pathway
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    25578 (Ywhaz)
   04151 PI3K-Akt signaling pathway
    25578 (Ywhaz)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    25578 (Ywhaz)
   04114 Oocyte meiosis
    25578 (Ywhaz)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    25578 (Ywhaz)
  09172 Infectious disease: viral
   05161 Hepatitis B
    25578 (Ywhaz)
   05160 Hepatitis C
    25578 (Ywhaz)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    25578 (Ywhaz)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25578 (Ywhaz)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    25578 (Ywhaz)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   25578 (Ywhaz)
SSDB
Motif
Pfam: 14-3-3 AAA_15 CSN7a_helixI FliM
Other DBs
NCBI-GeneID: 25578
NCBI-ProteinID: NP_037143
RGD: 3980
Ensembl: ENSRNOG00000008195
UniProt: P63102
Position
7
AA seq 245 aa
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWR
VVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQPESKVFYLK
MKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYE
ILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAG
EGGEN
NT seq 738 nt   +upstreamnt  +downstreamnt
atggataaaaatgagctggtgcagaaggccaagctggccgagcaggcagagcgatacgat
gacatggcagcctgcatgaagtctgtcactgagcaaggagccgagctgtctaacgaggag
aggaaccttctctctgttgcttataaaaacgttgtaggagcccgtaggtcatcttggagg
gtcgtctcgagtattgagcagaagacggaaggtgctgagaaaaagcagcagatggctcga
gaatacagagagaagatcgagacggagctgagggacatctgcaacgacgtactgtctctt
ttggaaaagttcttgatccccaatgcttcgcagccagaaagcaaagtcttctatttgaaa
atgaagggtgactactaccgctacttggctgaggttgctgctggtgatgacaagaaagga
attgtggaccagtcacagcaagcataccaagaagcatttgaaatcagcaaaaaggagatg
cagccgacacaccccatcagactgggtctggccctcaacttctctgtgttctactatgag
atcctgaactccccagagaaagcctgctctcttgcaaaaacagcttttgatgaagccatt
gctgaacttgatacattaagtgaagagtcgtacaaagacagcacgctaataatgcagtta
ctgagagacaacttgacattgtggacatcggatacccaaggagacgaagcagaagcggga
gaaggaggggaaaattaa

KEGG   Rattus norvegicus (rat): 29753
Entry
29753             CDS       T01003                                 

Gene name
Ywhae
Definition
(RefSeq) 14-3-3 protein epsilon
  KO
K06630  14-3-3 protein epsilon
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04151  PI3K-Akt signaling pathway
rno04390  Hippo signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04722  Neurotrophin signaling pathway
rno05160  Hepatitis C
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    29753 (Ywhae)
   04151 PI3K-Akt signaling pathway
    29753 (Ywhae)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    29753 (Ywhae)
   04114 Oocyte meiosis
    29753 (Ywhae)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    29753 (Ywhae)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    29753 (Ywhae)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    29753 (Ywhae)
  09172 Infectious disease: viral
   05160 Hepatitis C
    29753 (Ywhae)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    29753 (Ywhae)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    29753 (Ywhae)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    29753 (Ywhae)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   29753 (Ywhae)
SSDB
Motif
Pfam: 14-3-3 Orbi_VP5 Ta0938
Other DBs
NCBI-GeneID: 29753
NCBI-ProteinID: NP_113791
RGD: 62000
Ensembl: ENSRNOG00000005290
UniProt: P62260
Position
10
AA seq 255 aa
MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASW
RIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVF
YYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVF
YYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGE
EQNKEALQDVEDENQ
NT seq 768 nt   +upstreamnt  +downstreamnt
atggatgatcgggaggatctggtgtaccaggcgaagctggcagagcaggccgagcgatac
gacgaaatggtggaatcaatgaagaaagtagcaggaatggacgtggagctgacagttgaa
gaacgaaaccttttatctgttgcatataaaaatgtgattggagccagaagagcatcctgg
agaataatcagcagcattgaacagaaggaagaaaacaagggaggagaggacaaattaaag
atgattcgggagtaccggcaaatggttgaaactgagctcaagttaatctgttgtgacatt
ctggatgtactggacaagcacctcattccagcagctaacactggcgagtccaaggttttc
tattataaaatgaaaggggactaccacaggtatctggctgagtttgccacaggaaacgac
aggaaggaggcagcagagaacagccttgtggcttacaaagctgctagtgacattgcgatg
acagaacttcctccaacgcaccccattcgtttaggtcttgctctcaacttttccgtattc
tactatgaaattcttaattcccccgaccgtgcctgcaggttggcaaaagcagcttttgat
gacgcaattgcagaactggacacgctgagtgaagaaagctataaggactccacactcatc
atgcagctgctacgtgataacctgacgctgtggacctcagacatgcagggcgatggtgaa
gagcagaataaagaagcgctgcaggatgtggaagatgagaatcagtga

KEGG   Rattus norvegicus (rat): 56010
Entry
56010             CDS       T01003                                 

Gene name
Ywhag
Definition
(RefSeq) 14-3-3 protein gamma
  KO
K16198  14-3-3 protein gamma/eta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04151  PI3K-Akt signaling pathway
rno04390  Hippo signaling pathway
rno05160  Hepatitis C
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    56010 (Ywhag)
   04151 PI3K-Akt signaling pathway
    56010 (Ywhag)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    56010 (Ywhag)
   04114 Oocyte meiosis
    56010 (Ywhag)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    56010 (Ywhag)
  09172 Infectious disease: viral
   05160 Hepatitis C
    56010 (Ywhag)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    56010 (Ywhag)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    56010 (Ywhag)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    56010 (Ywhag)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     56010 (Ywhag)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    56010 (Ywhag)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   56010 (Ywhag)
SSDB
Motif
Pfam: 14-3-3 DUF3504 SF3A2 Peptidase_C98 Orbi_VP5
Other DBs
NCBI-GeneID: 56010
NCBI-ProteinID: NP_062249
RGD: 62002
Ensembl: ENSRNOG00000001436
UniProt: P61983
Position
12
AA seq 247 aa
MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSW
RVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESK
VFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYS
VFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDD
DGGEGNN
NT seq 744 nt   +upstreamnt  +downstreamnt
atggtggaccgcgagcaactagtgcagaaagcccggctggccgagcaggcggagcgctac
gacgatatggccgcggccatgaagaacgtgacagagctgaatgaaccactgtccaacgag
gaacggaacctcctgtcggtggcctacaagaacgtggttggggctcgccgctcctcctgg
agggtcatcagcagcatcgagcagaagacgtctgcggatggcaacgagaagaagatagag
atggtccgagcctaccgggaaaagattgagaaggagctggaggccgtgtgccaggacgtg
ctgagcctgctggacaactacctgatcaagaactgcagcgagacccagtacgagagcaag
gtgttctacctgaagatgaaaggggactattaccgctacctggccgaagtggccactggg
gagaaaagggcgaccgtggtggagtcgtccgagaaggcctacagcgaagcccacgagatc
agcaaggagcacatgcagcccacccaccccatccggctgggcctggcgctcaactactcc
gttttctactacgagatccagaacgccccagagcaagcctgccacctggccaagaccgcc
ttcgatgacgccatcgccgagctcgacactctgaacgaggactcctacaaggactccact
ctgatcatgcagctgctccgagacaacctaacgctctggacgagcgaccagcaagacgac
gacggcggcgaaggcaacaactaa

KEGG   Rattus norvegicus (rat): 56011
Entry
56011             CDS       T01003                                 

Gene name
Ywhab
Definition
(RefSeq) 14-3-3 protein beta/alpha
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04151  PI3K-Akt signaling pathway
rno04390  Hippo signaling pathway
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    56011 (Ywhab)
   04151 PI3K-Akt signaling pathway
    56011 (Ywhab)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    56011 (Ywhab)
   04114 Oocyte meiosis
    56011 (Ywhab)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    56011 (Ywhab)
  09172 Infectious disease: viral
   05161 Hepatitis B
    56011 (Ywhab)
   05160 Hepatitis C
    56011 (Ywhab)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    56011 (Ywhab)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    56011 (Ywhab)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    56011 (Ywhab)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   56011 (Ywhab)
SSDB
Motif
Pfam: 14-3-3 Peptidase_C98 FliM SF3A2
Other DBs
NCBI-GeneID: 56011
NCBI-ProteinID: NP_062250
RGD: 61998
Ensembl: ENSRNOG00000010945
UniProt: P35213
Position
3
AA seq 246 aa
MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSS
WRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICSDVLELLDKYLILNATHAESKVFY
LKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFY
YEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGD
AGEGEN
NT seq 741 nt   +upstreamnt  +downstreamnt
atgaccatggacaaaagtgagctggtacagaaagccaaacttgctgagcaagctgagcgt
tatgatgatatggccgcagctatgaaggctgtaacagagcagggacatgaactctccaat
gaagagaggaatctactctctgttgcctacaagaatgtggtaggtgcccgccgttcttcc
tggcgagtcatctccagcatcgaacagaaaacagagaggaatgagaagaagcagcagatg
ggcaaggagtaccgtgagaagatagaggccgagctgcaggacatctgcagtgacgttctg
gagctgttggacaaatatctcattctcaatgctacccatgcagaaagcaaagtgttctac
ttaaaaatgaaaggagactattttaggtatctttctgaagttgcatctggagataataaa
caaaccactgtgtcaaactcccagcaggcgtaccaagaagcatttgaaatcagcaagaaa
gaaatgcagcctacacacccgattcgccttggcctggctctgaatttctcagtcttttac
tatgagattctaaactctcctgaaaaggcctgtagcctggccaaaacggcgtttgatgaa
gccattgctgagttggacaccctgaatgaagagtcttacaaagacagcaccctgatcatg
cagctgctaagggacaatctcaccctgtggacgtcagaaaaccagggggatgaaggagat
gctggagagggagagaactaa

DBGET integrated database retrieval system