KEGG   Rattus norvegicus (rat): 25623
Entry
25623             CDS       T01003                                 

Gene name
Gys2
Definition
(RefSeq) glycogen [starch] synthase, liver
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00500  Starch and sucrose metabolism
rno01100  Metabolic pathways
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04910  Insulin signaling pathway
rno04922  Glucagon signaling pathway
rno04931  Insulin resistance
rno05415  Diabetic cardiomyopathy
Module
rno_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    25623 (Gys2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    25623 (Gys2)
   04152 AMPK signaling pathway
    25623 (Gys2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    25623 (Gys2)
   04922 Glucagon signaling pathway
    25623 (Gys2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    25623 (Gys2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    25623 (Gys2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    25623 (Gys2)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     25623 (Gys2)
Glycosyltransferases [BR:rno01003]
 Polysaccharide
  Storage polysaccharide
   25623 (Gys2)
SSDB
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Other DBs
NCBI-GeneID: 25623
NCBI-ProteinID: NP_037221
RGD: 2773
Ensembl: ENSRNOG00000059753
UniProt: D4A5K9
Position
4
AA seq 704 aa
MLRGRSLSVTSLGGLPAWEAERLPVEDLLLFEVSWEVTNKVGGICTVIQSKAKTTANEWG
ENYFLIGPYFEHNVKTQVEPCEPANDAVRKAVDAMNKHGCQVHFGRWLIEGSPYVVLFDI
SSSAWNLDRWKGDFWEACGVGIPHDDREANDMLIFGSLTAWFLKEVTDHADGKHVIAQFH
EWQAGTGLILSRARKLPIATIFTTHATLLGRYLCAANIDFYNQLDKFNIDKEAGERQIYH
RYCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPNGLNVKKFSAVHEFQNLHATY
KARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSRLNFLLRMHKSNV
TVVVFFIMPAKTNNFNVETLKGQAVRKQLWDTVHCMKEKFGKKLYDGLLRGEIPDMNSIL
DRDDLTIMKRAIFSTQRHSLPPVTTHNMIDDSTDPILSTIRRIGLFNNRTDRVKVILHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQE
HVADPTAYGIYIVDRRFRSPDDSCNQLTQFLYGFCKQSRRQRIIQRNRTERLSDLLDWRY
LGRYYQHARHLTLSRAFPDKFHLEPTSPPTTDGFKYPRPSSVPPSPSGSQTSSPQSSDVE
NEGDEDERYDEEEEAERDRLNIKSPFSLNHIPKGKKKLHGEYKN
NT seq 2115 nt   +upstreamnt  +downstreamnt
atgctcaggggccgctccttgtctgtgacgtcccttggtgggctccctgcatgggaagct
gaaagactccccgtggaagacttattgctttttgaagtttcctgggaagtgaccaacaaa
gttgggggcatctgtactgtgatccagagcaaagccaaaaccacagccaatgaatgggga
gagaattacttcctgataggtccgtattttgagcataatgtgaagactcaagtagagcca
tgcgagcccgccaacgatgccgtcagaaaagctgtggatgccatgaacaaacatggctgc
caggtgcattttggaagatggctgatagaagggagtccgtatgtggtgctttttgacatc
agctcctcagcgtggaacctggacaggtggaagggagacttctgggaagcatgtggcgtt
ggcatccctcacgacgaccgagaagccaatgacatgctcatatttgggtctttaactgcc
tggttcttaaaggaggtgacggaccatgcagacggtaaacacgtcattgcccaattccat
gaatggcaggctggaactgggctgatcctttctcgtgccaggaaactccccatcgccaca
atatttacaacccatgccacactgctggggcggtatctctgtgcagcaaatattgacttc
tacaaccagcttgataagttcaacatagacaaagaggccggggagaggcagatttatcac
cgctactgcatggagcgggcttccgtgcactgtgcgcacgtgtttaccacagtgtcagaa
atcacagccatcgaggcggagcacatgctgaagaggaagcctgatgtggtgactccaaac
ggcttgaacgttaagaagttttctgcggtgcacgagtttcaaaatctccatgccacatac
aaggccaggatacaggattttgttcgaggtcatttctatggccacctggacttcgatctt
gaaaagacgttatttcttttcattgctgggaggtatgagttctccaacaagggagcagac
atcttcctagaatccttatccaggctcaatttcctcctaaggatgcataagagtaacgtc
actgtggtagtgtttttcatcatgcctgccaagacaaacaatttcaacgtggaaaccctg
aagggccaggcggtgcggaaacagctgtgggacactgtgcactgtatgaaggaaaagttt
ggaaagaaactctacgatgggttattaagaggagaaatacccgacatgaatagtattttg
gatcgagatgacttaacaattatgaaaagagccattttttcaactcagagacactctttg
cctcctgtgaccactcacaatatgatcgacgattccacggatcccatcctcagcaccatt
cgacgaattggacttttcaacaatcgcacagacagagtcaaggtgattttacacccagaa
ttcctgtcctccaccagccccctactaccaatggattatgaagagtttgtccgaggctgt
caccttggggtatttccatcatactatgagccctggggttacacgccagccgaatgcaca
gtgatgggcatccccagtgtgactacgaacctctctggtttcgggtgtttcatgcaggag
catgtggctgaccctaccgcgtacggtatttatatcgtcgacagacgcttccgctctcca
gatgattcttgcaaccagctgactcagtttctctatgggttctgtaaacagtcccgccgc
caaagaatcatccagaggaaccgcaccgagaggctttcagatcttctggactggagatac
ctgggcagatattaccagcatgccagacatctgacactgagcagggcttttccagacaaa
ttccacctggagcccacatccccaccaacgacggatggctttaagtatcccaggccctcc
tcagtaccaccttccccatcaggatcccagacttcaagtcctcagagcagcgatgtggaa
aacgaaggggatgaggatgagagatatgatgaggaagaggaggctgagagggaccggcta
aacatcaagtcaccattttccctgaaccacatcccaaaggggaagaaaaagcttcatgga
gaatataagaactga

KEGG   Rattus norvegicus (rat): 690987
Entry
690987            CDS       T01003                                 

Gene name
Gys1
Definition
(RefSeq) glycogen [starch] synthase, muscle
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00500  Starch and sucrose metabolism
rno01100  Metabolic pathways
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04910  Insulin signaling pathway
rno04922  Glucagon signaling pathway
rno04931  Insulin resistance
rno05415  Diabetic cardiomyopathy
Module
rno_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    690987 (Gys1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    690987 (Gys1)
   04152 AMPK signaling pathway
    690987 (Gys1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    690987 (Gys1)
   04922 Glucagon signaling pathway
    690987 (Gys1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    690987 (Gys1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    690987 (Gys1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    690987 (Gys1)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     690987 (Gys1)
Glycosyltransferases [BR:rno01003]
 Polysaccharide
  Storage polysaccharide
   690987 (Gys1)
SSDB
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glycos_transf_1 Glyco_transf_5 Glyco_trans_1_4
Other DBs
NCBI-GeneID: 690987
NCBI-ProteinID: NP_001103085
RGD: 1589798
Ensembl: ENSRNOG00000020812
UniProt: A2RRU1
Position
1
AA seq 738 aa
MPLSRSLSMSSLPGLEDWEDEFDPENAVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTPELKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQNEEKPYVVAHFH
EWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADIFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALAKAFPDHFTYEPHEVDATQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EEPRDGPLREDSERYDEEEEAAKDRRNIRAPEWPRRASCSSSTGGSKRSNSVDTGPSSSL
STPTEPLSPTSSLGEERN
NT seq 2217 nt   +upstreamnt  +downstreamnt
atgcctctcagccgcagtctctctatgtcctcgcttccaggattggaagactgggaggat
gaattcgacccggagaacgcagtgcttttcgaggtggcctgggaggtggccaacaaggtg
ggtggcatctacactgtgctgcagacgaaggcgaaggtgaccggggatgaatggggtgac
aactactatctggtgggaccatacacggagcagggtgtgaggacgcaggtggagctcctg
gagcccccaactcctgaactgaagaggactctggattccatgaacagcaagggctgtaag
gtgtattttgggcgttggctgatcgaggggggacccctagtggtgctcctggatgtaggg
gcctcagcctgggccctggagcgctggaagggtgaactttgggacacctgcaacatcggg
gtaccctggtacgaccgtgaggccaatgatgccgtcctgtttggtttcctcaccacctgg
ttcctgggtgagttcctggcccagaatgaagagaagccatatgtggtcgcccacttccat
gaatggttggcaggcgttggtctgtgtctgtgccgagcccggcgtttgccggtggcaacc
atcttcaccactcacgccacgctgctgggtcgctacctatgtgctggtgccgtggacttc
tacaacaacctggagaatttcaatgtagacaaggaagcaggcgagaggcagatctatcac
cggtactgcatggagcgggcagcagcccactgtgcccatgtcttcactacagtgtcccag
atcaccgcgattgaggctcaacacctcctcaagaggaaaccagatattgtgacccccaat
ggactaaatgtgaagaagttctctgctatgcacgaattccagaaccttcacgctcagagc
aaagcacgaatccaggagtttgtgcgtggccatttttatgggcacctggacttcaaccta
gacaagactttgtatttctttatcgctggacgctatgagttttccaacaagggagctgat
atattcctggaggcattggcccggctcaactacctgctcagagtgaatggcagcgagcaa
actgttgtggcattcttcatcatgccggctcggaccaacaacttcaacgtggaaaccctg
aagggccaagccgtgcgcaaacagctatgggacacagccaatacagtcaaggagaaattt
gggaggaagctctacgaatccctattagtgggtagcctccccgacatgaacaagatgctg
gacaaggaggacttcactatgatgaagagagccatctttgcgactcagcggcagtctttc
ccaccggtgtgtacccacaacatgctggatgactcttcagaccccatcttgaccaccatc
cgacgaatcggccttttcaacagtagtgcggaccgtgtgaaggtgatttttcacccagaa
ttcctttcttccacaagccctctgctccccgtggactatgaagagttcgtccgtggctgt
caccttggagtcttcccctcctactatgagccctggggctacacaccagcggagtgcact
gtcatgggcatcccgagcatctccacgaacctctccggctttggctgctttatggaggag
cacattgcagatccctcggcttacggcatttacattctggatcggaggttccgaagcctg
gatgattcatgctcccaactcacctccttcctgtacagcttctgtcagcagagccggcga
cagcgcatcattcagcggaatcgcacagagcgattgtcagacctgctggattggaagtac
ctaggccggtactacatgtctgcgcgccacatggctctggccaaggcctttccagaccac
ttcacctatgagccccatgaggtagatgcgacccaggggtaccgttacccacggccggcc
tccgtgccaccgtcaccctcactgtctcgacactccagcccacaccagagtgaggatgaa
gaagagccacgggatggacccctgagggaagacagtgagcgttatgatgaggaagaagag
gctgccaaggaccgccgcaacatccgggcacccgagtggccacgccgggcctcctgctcc
tcctccacaggcggcagcaagagaagcaactcagtggacactgggccctccagctcactc
agtacacccactgagcccctgagtcctaccagttccctgggcgaggagcgcaactaa

DBGET integrated database retrieval system