KEGG   Rattus norvegicus (rat): 25660
Entry
25660             CDS       T01003                                 

Symbol
Cd28
Name
(RefSeq) T-cell-specific surface glycoprotein CD28 precursor
  KO
K06470  CD28 antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules
rno04660  T cell receptor signaling pathway
rno04672  Intestinal immune network for IgA production
rno04940  Type I diabetes mellitus
rno05162  Measles
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05320  Autoimmune thyroid disease
rno05322  Systemic lupus erythematosus
rno05323  Rheumatoid arthritis
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    25660 (Cd28)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    25660 (Cd28)
   04672 Intestinal immune network for IgA production
    25660 (Cd28)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    25660 (Cd28)
  09172 Infectious disease: viral
   05162 Measles
    25660 (Cd28)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    25660 (Cd28)
   05323 Rheumatoid arthritis
    25660 (Cd28)
   05320 Autoimmune thyroid disease
    25660 (Cd28)
   05330 Allograft rejection
    25660 (Cd28)
   05332 Graft-versus-host disease
    25660 (Cd28)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    25660 (Cd28)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    25660 (Cd28)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    25660 (Cd28)
CD molecules [BR:rno04090]
 Proteins
  25660 (Cd28)
SSDB
Motif
Pfam: V-set_2 V-set Raffinose_syn Ly49
Other DBs
NCBI-GeneID: 25660
NCBI-ProteinID: NP_037253
RGD: 2299
Ensembl: ENSRNOG00000010283
UniProt: P31042
Position
9
AA seq 218 aa
MTLRLLFLALSFFSVQVTENKILVKQSPLLVVDNNEVSLSCRYSYNLLAKEFRASLYKGV
NSDVEVCVGNGNFTYQPQFRPNVGFNCDGNFDNETVTFRLWNLHVNHTDIYFCKIEVMYP
PPYLDNEKSNGTIIHIKEKHLCHAQTSPKLFWALVVVAGVLLCYGLLVTVTLCIIWTNSR
RNRLLQSDYMNMTPRRLGPTRKHYQPYAPARDFAAYRP
NT seq 657 nt   +upstreamnt  +downstreamnt
atgacactcagactgctattcttggctctcagcttcttctcagttcaagtaacagaaaac
aagattttggtgaagcagtccccgctgcttgtggtagataacaatgaggtcagcctcagc
tgcaggtattcctacaaccttcttgcaaaggagttccgggcatccctttacaagggcgtg
aacagtgacgtggaagtctgtgtcgggaatgggaattttacctatcagccccagttccgc
ccaaacgtggggttcaactgtgatgggaatttcgacaatgaaacagtgacgttccgtctc
tggaatctgcatgttaatcacacagatatttacttctgcaaaatcgaggtcatgtatcct
ccgccatacctggacaacgagaagagcaacggaactattattcacataaaagagaaacat
ctttgtcatgctcagacgtctcctaagctgttttgggcactggtcgtggttgctggagtc
ctgctgtgttatggcttgctagtgacagtgactctttgtattatctggacaaatagcaga
aggaacaggctccttcaaagtgactacatgaacatgacaccgcggagactcgggcccacg
cgcaagcattaccaaccctatgccccagcgagagactttgcagcgtaccgcccctga

DBGET integrated database retrieval system