KEGG   Rattus norvegicus (rat): 287871
Entry
287871            CDS       T01003                                 

Gene name
Rptor
Definition
(RefSeq) regulatory-associated protein of mTOR
  KO
K07204  regulatory associated protein of mTOR
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04136  Autophagy - other
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04714  Thermogenesis
rno04910  Insulin signaling pathway
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    287871 (Rptor)
   04152 AMPK signaling pathway
    287871 (Rptor)
   04150 mTOR signaling pathway
    287871 (Rptor)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    287871 (Rptor)
   04136 Autophagy - other
    287871 (Rptor)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    287871 (Rptor)
  09149 Aging
   04211 Longevity regulating pathway
    287871 (Rptor)
   04213 Longevity regulating pathway - multiple species
    287871 (Rptor)
  09159 Environmental adaptation
   04714 Thermogenesis
    287871 (Rptor)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    287871 (Rptor)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    287871 (Rptor)
Membrane trafficking [BR:rno04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    287871 (Rptor)
SSDB
Motif
Pfam: Raptor_N HEAT HEAT_2 WD40 Cnd1 Peptidase_C14
Other DBs
NCBI-GeneID: 287871
NCBI-ProteinID: NP_001127971
RGD: 1311784
Ensembl: ENSRNOG00000003821
UniProt: D3ZDU2
Position
10
AA seq 1335 aa
MESEMLQSPLMGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSV
ALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYK
QSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIY
DLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNC
IQLAACEAHELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPG
RLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSY
NCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWL
TMGVENRSPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLL
QSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILA
VIVNSYTTGQEACLQGNLIAICLEQLSDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSA
HEKLYSLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLINDGSPMVR
KELVVALSHLVVQYESNFCTVALQFMEEEKNYPLPSPAATEGGSLTPVRDSPCTPRLRSV
SSYGNIRAVTTARNLNKSLQNLSLTEESGSSVAFSPGNLSTSSSASSTLGSPENEEYILS
FETIDKMRRVSSYSALNSLIGVSFNSVYTQIWRVLLHLAADPYPDVSDLAMKVLNSIAYK
ATVNARPQRILDTSSLTQSAPASPTNKGMHIHQVGGSPPASSTSSCSLTNDVAKQTVSRD
LPSSRPGTAGPTGAQYTPHSHQFPRTRKMFDKGPDQTTDDADDAAGHKSFICATMQTGFC
DWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNTRVRKQAQQVIQKGITRLDDQIFLN
RNPGVPSVVKFHPFTPCIAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQD
CSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMS
SGDVRIVRIWDTDRETKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALS
ECRVMTYREHTAWVVKAYLQKHPEGHIVSVSVNGDVRFFDPRMPESVNVMQIVKGLTALD
IHPQANLIACGSMNQFTAIYNGNGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGS
NDYYISVYSVEKRVR
NT seq 4008 nt   +upstreamnt  +downstreamnt
atggagtcggagatgctgcagtcgcctcttatgggactcggggaggaagatgaggcagac
cttacagattggaacttgcctttggcgtttatgaaaaagagacattgtgagaaaattgaa
ggctccaaatctttagcacagagctggagaatgaaggatcggatgaagaccgtcagtgtg
gccttggtcctgtgcctgaatgtgggtgtggatcctccagatgtggtgaagaccacacct
tgtgctcgattggaatgctggattgatcctctgtctatgggtcctcagaaagctctggaa
accatcggtgcaaatctacagaagcagtatgagaactggcagccaagggctcggtacaag
cagagccttgaccccactgtggatgaagtcaagaaactttgcacatctctgcgtcggaac
gccaaggaggaacgggtcctcttccactataatggccatggggtgcccaggcctacggtg
aatggagaggtctgggtcttcaacaagaactacactcagtacatcccactgtccatatat
gacctgcagacgtggatgggcagcccatccatctttgtctacgactgctccaatgctggc
ctcatcgtcaagtccttcaaacagttcgcactgcagagggagcaggaactagaggtagct
gcaattaacccaaaccatccacttgcccagatgcccttgcctccctcaatgaaaaactgc
atccagctggcagcctgtgaggcccacgagctcctgccgatgatccctgacctcccagcc
gacctgttcacatcctgcctcaccactcccatcaagattgctttgcgctggttttgcatg
cagaagtgtgttagtctggtgcctggagtcacactggatttgatagaaaagatccctggc
cggctgaatgaccggagaacccctctgggtgaactgaactggatcttcacagccatcaca
gacaccatcgcctggaatgtgctccctcgggatctctttcaaaagcttttccgacaggac
ctgctggtggcaagtttgtttagaaattttttattggcagaaagaatcatgaggtcgtat
aactgcaccccagtaagcagcccacgacttcccccaacatacatgcatgccatgtggcag
gcctgggaccttgctgtggacatttgcctctctcaactgccaaccatcatcgaagaggga
actgccttcaggcacagcccattctttgctgagcagctgacggcattccaggtgtggctc
accatgggtgtggaaaacaggagcccccccgagcagctgcccatcgtcctacaggtgctg
ctaagccaggtgcaccggctgagagccttggacttgctgggacgatttttggacttgggc
ccttgggcggtgagcttggccctgtcggtgggcatcttcccctatgtactgaagctgctt
cagagctcggcccgagagctgcggccactccttgtcttcatctgggccaaaatcctcgct
gtggacagttcatgccaggctgacctcgtgaaggacaacggtcacaagtacttcctgtcc
gtcttggcagacccatacatgccagctgaacacaggaccatgacagccttcattcttgct
gtaatcgtcaacagctacacaacagggcaagaagcctgcctgcaggggaacctgattgcc
atctgtttggagcagctcagtgacccacaccccttgctacgccagtgggtggccatttgc
ctgggaaggatctggcagaactttgattctgcaaggtggtgtggggtgagagacagcgcc
cacgaaaaactctatagcctcctctccgaccccatccctgaggtacgatgtgcagctgtg
tttgcccttggtacctttgtgggaaactctgctgagaggacagaccactctactaccatt
gaccacaatgtggccatgatgctggctcagctgattaatgatggaagccccatggtccgg
aaggagctggtggtggctctgagtcaccttgtagtccaatatgagagcaatttctgcact
gtggccctgcagttcatggaagaggaaaagaactaccccttgccttctccagcagccaca
gagggagggagcttgactccagttcgagacagcccgtgcacccccagactccggtcagtg
agctcctatgggaacatccgagccgtcaccacagctaggaacctgaacaaatctttgcag
aacctgagcttgacggaagaatcgggcagctcagtggccttctctcccgggaacctcagt
acaagtagtagtgccagcagcaccttgggaagccctgagaacgaggagtatatcctgtcc
ttcgagaccatcgacaagatgcggcgtgtgagctcctattcagcgctcaactccctcata
ggagtctcctttaatagtgtctacactcagatttggagagtcttactgcatttggccgct
gatccctacccagatgtttctgacttagccatgaaagtcctcaacagcattgcttacaag
gccacagtcaacgcccggccccagcgaatcctcgacacatcctctctcacacagtcggcc
ccagccagcccaaccaacaagggcatgcacatccaccaggtgggaggctccccgccagca
tctagcaccagcagctgcagcctgaccaatgatgtggccaagcagacggtcagccgtgac
ctgccctccagccgcccgggtactgccggccccacaggggcacagtacacccctcactcc
caccagttccctcgtacacgaaagatgtttgacaaaggccctgatcagaccacagacgat
gcagatgatgctgccggacacaagagcttcatttgtgccactatgcagacggggttctgt
gactggagtgcccgctactttgcccagccggtcatgaagatccctgaagagcatgaccta
gagagtcagatccgcaaggagcgtgagtggcggttcctgaggaacactcgagtcaggaag
caggcacagcaggtcatccagaagggcatcaccagactggatgatcagatatttctgaac
aggaaccccggcgttccctctgtggtcaaattccacccctttacaccatgcatagctgtt
gctgacaaggacagcatctgtttttgggactgggagaaaggagagaaactggactacttc
cacaatggtaaccctcggtacaccagagtcactgctatggagtacctgaatgggcaggac
tgctccttgctgctgacagccacagacgatggagccatcagggtctggaaaaattttgct
gatttggaaaagaatccagagatggtgactgcgtggcaagggctctcagacatgcttcca
acaacacgaggagctgggatggtggtggactgggaacaagaaactggcctcctcatgagc
tcaggggacgtgcgcattgtccggatctgggataccgaccgggagacgaaggtccaggac
atccccacgggggccgacagctgtgtgacaagtttatcttgtgattcgcaccgctcactc
attgtagctggcctgggtgatggctcgatccgtgtctacgacaggaggatggcactcagt
gaatgccgggtcatgacttaccgagagcacacagcatgggtggtaaaggcctacctgcag
aagcaccctgagggccacatcgtgagtgtgagtgtcaatggagatgtgcgattcttcgat
cctcggatgcctgagtctgtgaatgtaatgcagattgtgaaggggctgacagccctcgac
atccacccccaggcaaacctgatcgcctgtggctccatgaaccagttcacagccatctac
aacggcaatggggagctgatcaacaacatcaaatactacgatggcttcatgggccagcga
gtcggggccatcagctgcctggctttccacccacactggcctcatctggccgtcggaagc
aatgactactacatttctgtatattcggtggagaagcgtgtcagatag

DBGET integrated database retrieval system