KEGG   Rattus norvegicus (rat): 287961
Entry
287961            CDS       T01003                                 

Gene name
Cdc45
Definition
(RefSeq) cell division control protein 45 homolog
  KO
K06628  cell division control protein 45
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    287961 (Cdc45)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    287961 (Cdc45)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   Other initiation factors
    287961 (Cdc45)
Motif
Pfam: CDC45 DUF3848
Other DBs
NCBI-GeneID: 287961
NCBI-ProteinID: NP_001099336
RGD: 1590928
Ensembl: ENSRNOG00000050071
UniProt: B1WBZ4
Position
11
AA seq 570 aa
MFVTDFRKEFYELVHNQRVLLFVASDVDALCACKILQALFQCDHVQYTLVPVSGWQELET
AFLEHKEQFSYFILINCGANVDLLDILQPDEDSIFFVCDTHRPVNVVNVYNDTQIKLLIK
QEDDLEVPAYDDIFRDEAEDEEDLSENDDGGAEPSEKRLRLEGLEEEIVERNRKRRQRRE
WEARRKDILFDYEQYEYYGTSSAMVMFDLAWMMSKDLNDMLWWAIVGLTDQWLHDKITQM
KYVTDVGVLQRHVSRHNHRNEAEENMLSVDCTRISFEYDLCLVLYQHWSLHESLYNTSYT
AARFKLWSVHGQKRLQEFLADMGLPLKQVKQKFQSMDVSLKENLREMIEESANKFGMKDI
RVQTFSIQFGFRHKFLASDVVFATMSLMERPEKDGSGTDHFIQALDSLSRSNLDKLYLGL
ELAKKHLQATQQTIASCLCTNLVTSQGPFLYCSLMEGTPDVALFSKPASLSLLSRHLLKS
FVCSTKNRRCKLLPLVMAAPLSMEQGTVTVVGIPPETDSSDRKNFFGRAFEKAAESTSSR
TLHNYFDLSVIELKAEDRSKFLDALVSLLS
NT seq 1713 nt   +upstreamnt  +downstreamnt
atgttcgtgaccgatttccgcaaggagttctacgagctagtccacaaccagagggtcctt
ctctttgtggcctcggacgtggatgccttgtgtgcttgcaagatacttcaggccctgttt
caatgtgaccacgtacagtatacgctggttccagtctctgggtggcaagaacttgaaact
gcgtttcttgaacataaagagcaattctcctatttcatcctcataaactgtggcgctaac
gtggacctgttggatatccttcagcctgacgaagacagtatattttttgtgtgtgatacc
cacaggccagtgaacgttgtgaatgtgtataatgacactcagatcaaattgcttattaaa
caagaggatgacctcgaagttcctgcctatgatgacatctttagagatgaagcagaggat
gaagaagatctttcagaaaatgacgatggtggggcagagccttcagagaagcgcttacgg
ttagaagggttagaagaggagatagtggagcgaaacaggaagaggaggcagcgcagggag
tgggaggcccggaggaaagacatcctcttcgactacgagcagtatgaatattatgggaca
tcctcagccatggtgatgtttgacctggcttggatgatgtccaaggacctgaatgacatg
ctgtggtgggccattgttgggttgacagaccaatggctgcacgacaagatcactcaaatg
aagtatgtgactgatgttggcgtcctgcagcgtcatgtgtcccggcataaccaccgaaac
gaggcggaggagaacatgctctctgtggactgcacccggatctcctttgagtacgacctc
tgcctggtactgtaccagcactggtccctccatgagagcctgtacaacaccagctacact
gcagccaggttcaagctctggtctgtgcatgggcagaagcgactccaggagttccttgca
gacatggggcttcccctgaagcaagtgaaacagaaatttcagtccatggacgtttccctg
aaggagaatcttcgagaaatgattgaagaatctgcaaataagtttgggatgaaggatatt
cgtgtgcagactttcagcattcagtttgggttcaggcataaattcctggccagtgatgtc
gtctttgccaccatgtctctaatggagaggcccgagaaggatggctcagggacagaccac
ttcatccaagctctcgatagcctctccaggagtaacctggacaagctgtaccttggtcta
gagctcgccaagaagcacctccaagccacccagcagaccatcgccagctgtctctgtacc
aacctcgtcacctcccagggcccttttctctactgctcactcatggagggcactccagat
gtcgcactgttctccaagccagcatccttgagtctgctcagcaggcatctgctcaagtcc
tttgtgtgctcgacgaagaatcgacgctgcaaactgctgcccctggtgatggctgcccca
ctgagcatggagcagggcacagtgactgtggtgggcatccctccagagactgatagctcg
gatagaaagaacttttttggtcgggcatttgagaaggcagcagaaagcaccagctcccgg
actctacacaactactttgacctctcagtaattgagctgaaagctgaggaccggagcaag
ttcctggatgctcttgtgtcactgctgtcctga

DBGET integrated database retrieval system