KEGG   Rattus norvegicus (rat): 288663
Entry
288663            CDS       T01003                                 

Gene name
Atxn2
Definition
(RefSeq) ataxin-2 isoform X1
  KO
K23625  ataxin 2/2L
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05014  Amyotrophic lateral sclerosis
rno05017  Spinocerebellar ataxia
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    288663 (Atxn2)
   05017 Spinocerebellar ataxia
    288663 (Atxn2)
   05022 Pathways of neurodegeneration - multiple diseases
    288663 (Atxn2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    288663 (Atxn2)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     288663 (Atxn2)
SSDB
Motif
Pfam: SM-ATX LsmAD PAM2 LSM
Other DBs
NCBI-GeneID: 288663
NCBI-ProteinID: XP_038946069
RGD: 1306637
Ensembl: ENSRNOG00000001256
Position
12
AA seq 1429 aa
MQVSAPKAPAGHPLCCIWWGGNQGPRRGLRTPGQPTVPVREAGPAAEDKHSLLEGQTRLS
EGGSPTALPRPRRANAAQRCARSSRVPDRPPSRLTFDFRLTLPTSGKESPPLCFASPRPP
GRVAPYASASPAPMRPSTDAAQRPAAGPEPRRLSGWAARRSLPRTARRGGRGGAVAYPSA
GPPPRGPGAPPRGPRSPPCASDCFGSNGNGASRPGSRRLFGVCGPPRPFVVVLLPLAPAT
APARACPLGVRASPPRSGVSSARPAPGCPRPACEPVYGPLTMSLKPQPQPPAPASGRKPG
GGLLSSPGAAPASAASTSSSVVPAPAAPVASSSAVAGGGRPGLGRGRNSSKGLPQPTISF
DGIYANVRMVHILTSVVGSKCEVQVKNGGVYEGVFKTYSPKCDLVLDAAHEKSTESSSGP
KREEIMESVLFKCSDFVVVQFKDTDSSYARRDAFTDSALSAKVNGEHKEKDLEPWDAGEL
TASEELEALENDVSNGWDPNDMFRYNEENYGVVSTYDSSLSSYTVPLERDNSEEFLKREA
RANQLAEEIESSAQYKARVALENDDRSEEEKYTAVQRNCSDREGHGTNTRENKYIPPGQR
NREVISWGSGRQSSPRMGQPGPGSMPSRATSHTSDFNPNAGSDQRVVNGVFILSFISFVL
SGVPWPSPCPSPSSRPPSRYQSGPNSLPPRAATPTRPPSRPPSRPSRPPSHPSAHGSPAP
VSTMPKRMSAEGPPRMSPKAQRHPRNHRVSAGRGSMSSGLEFVSHNPPSEAAAPPVARTS
PAGGTWSSVVSGVPRLSPKTHRPRSPRQNSAGNSPSGPVLASPQAGITPAEAVSMPVPAA
SPTPASPASNRALTPSIEAKDSRLQDQRQNSPAGNKENIKASETSPSFSKAENKGVSPVI
SEHRKQIDDLKKFKNDFRLQPSSTSESMDQLLSKNREGEKSRDLMKDKTEASAKDSFIDS
GSSSCTSSSSKTNSPSASPSVLSNAEHKRGPEVTSQGVQTSSPACKQEKDDREERKDTTE
QVRKSTLNPNAKEFNPRSFSQPKPSTTPTSPRPQAQPSPSMVGHQQPAPVYTQPVCFAPN
MMYPVPVSPGVQPLYPIPMTPMPVNQAKTYRAGKVPNMPQQRQEQHHQSTMMHPASAAGP
PIVATPPAAYSTQYVAYSPQQFPNQPLVQHVPHYQSQHPHVYSPVIQGNARMMAPPAHAQ
PGLVSSSAAQFGAHEQTHAMYACPKLPYNKETSPSFYFAISTGSLAQQYAHPNATLHPHP
PHPQPSATPTGQQQSQHGGSHPAPSPVQHHQHQAAQALHLASPQQQSAIYHAGLAPTPPS
MTPASNTQSPQSSFPAAPQTVFTIHPSHVQPAYTTPPHMAHVPQAHVQSGMVPSHPTAHA
PMMLMTTQPPGGPQAALAQSALQPIPVSTTAHFPYMTHPSVQAHHQQQL
NT seq 4290 nt   +upstreamnt  +downstreamnt
atgcaggtctccgccccgaaggcgcccgcgggccatcctctatgttgcatctggtggggg
ggaaaccaaggtccccgaagggggctgaggacacccgggcagcccacggtgcccgtccgc
gaagcagggccagcggccgaagacaagcattccctcctcgaagggcagacccgcctcagc
gagggcggatcccccacggccctaccccgaccccggagagcgaacgcggcccagcgctgc
gcccgctcctcacgtgtccccgatcggcccccgagccgtctcacgttcgacttccgcctg
acccttccgacttccggtaaagagtcccccccgctctgtttcgcatctccgcgccctcca
ggccgcgtcgccccgtacgcgtccgcgagcccggctcccatgcgtccgtcgacagacgcc
gctcagcggcccgcggcaggccccgagccgcgccgcctgtcgggctgggccgcgcggcgc
tcgctcccgcggacggcgcggcgcggcgggcggggcggcgcggtagcatatccctccgcc
ggccctcccccgcgcggccccggcgcccctccccgcgggccgcgctcgccgccctgcgcc
tcagactgttttggtagcaacggcaacggcgcgtcccggcccggctcccggcggctgttc
ggtgtctgcgggcctccccgccccttcgtcgtcgtcctgctgcctctggcacccgcgacc
gcgccagcccgcgcctgcccgctcggcgtccgcgcgtccccgccgcgctccggcgtctcc
tcagcgcgcccggctcccggctgtccccgcccggcgtgcgagccggtgtatgggccgctc
accatgtcgctgaagccgcagccgcagccgcccgcgcccgccagtggccgcaagcccggc
ggcggcctgctctcgtcgcccggcgccgcgccggcctcggccgcgtcgacctcgtcttcc
gtggtgccggcccctgccgcgccggtggcgtcttcctcggcggtcgcgggcggcgggcgt
cccggcctgggcagaggtcggaacagtagcaaaggactgcctcagcctacgatttctttt
gacggaatctatgcaaacgtgaggatggttcatatacttacatcggttgtgggatcgaaa
tgtgaagtacaagtgaaaaacggaggtgtatatgaaggagtttttaaaacatacagtcct
aagtgtgatttggtacttgatgctgcacatgagaaaagtacagaatccagttcggggcca
aaacgtgaagaaataatggagagtgttttgttcaaatgctcagacttcgttgtggtacaa
tttaaagatacagactcgagttatgcacgaagagatgctttcactgactctgctctcagt
gctaaagtgaatggtgaacacaaggagaaggacctggagccctgggatgcaggggagctc
acagccagcgaggagctggaggctctggagaatgatgtgtctaacggatgggatcccaat
gatatgtttcgatataatgaagagaattacggtgtggtgtccacatacgatagtagttta
tcttcatatacggttcccttagaaagggacaactcagaagaatttctaaaacgggaggca
agggcaaaccagttagcagaagaaatcgagtccagtgctcagtacaaagctcgtgtggcc
cttgagaatgatgaccggagtgaggaagagaagtacacagcagtccagagaaactgcagt
gaccgggaaggtcatggcaccaacactagggaaaataaatatattcctcctggacaaaga
aacagagaagtcatatcctggggaagtgggagacagagctcaccacggatgggccagcct
ggaccaggctccatgccatcaagagctacttctcacacttcagatttcaacccgaatgct
ggctcagaccaaagagtagttaatggagtttttatactttccttcatatcatttgttctg
tcaggtgttccctggccatcgccttgcccatctccttcctctcgcccaccttctcgctac
cagtcaggtcccaactctcttccacctcgggcagccacccctacacggccgccctccagg
cccccctcgaggccctccagacccccgtctcacccctctgctcatggttctccagctcct
gtctctactatgcctaaacgcatgtctgcagaaggcccaccaaggatgtctccaaaggca
cagcggcaccctcggaatcatagagtctccgctgggagaggctccatgtctagtggccta
gaatttgtatcccacaatcccccaagtgaagcagctgctcctccagtggcaaggaccagt
cctgcagggggaacgtggtcctcagtggtcagtggggttccaagactatctcccaaaact
cacagacccaggtctcccaggcagaacagcgctggaaactctcccagcgggcctgtgctc
gcttctccccaagctggcatcacccctgccgaagccgtttccatgccggtccccgccgcg
tcccctactcctgccagccctgcgtccaacagagctctgaccccatctatcgaggcgaaa
gattccaggcttcaagatcagaggcagaactctcctgcagggaataaagaaaatattaaa
gcaagtgaaacatcacctagcttttcaaaagctgaaaacaaaggtgtgtcaccagttatc
tctgaacacagaaaacagatcgatgatttaaagaagtttaagaatgattttaggttacag
ccaagttctacgtctgaatctatggatcaactactaagcaaaaacagagaaggagaaaag
tcacgagatttgatgaaagacaaaacggaagcaagtgctaaggacagcttcattgacagt
ggcagcagcagctgcaccagcagcagcagcaagaccaacagccccagcgcctccccttct
gtgcttagtaatgcagagcacaagagggggcctgaggtcacgtcccagggggtgcagact
tccagtccggcctgcaaacaagagaaggatgaccgagaagagcggaaagacacaaccgag
caagttaggaagtcgactttgaatcccaatgcaaaggagttcaaccctcgttctttctct
cagccaaagccttctactaccccaacgtcgcctcggcctcaagcccagcccagcccgtcc
atggtgggtcatcagcagccagctccagtgtacacgcagcctgtgtgctttgcacccaat
atgatgtaccctgtcccagtgagcccaggcgtgcagcctttatacccaatacctatgacg
cccatgccagtgaaccaagccaagacatatagagcaggtaaagtaccaaatatgccccaa
cagcgacaagagcagcaccatcaaagcaccatgatgcaccctgcctccgcagcagggccg
cctatcgttgccaccccgcccgccgcttactccacgcagtacgttgcctacagccctcag
cagtttcccaaccagcctttggtccagcacgtgccgcattatcagtctcagcatcctcat
gtgtacagtcctgtcatacaaggtaatgccaggatgatggcaccaccagcacatgctcag
cctggtttagtgtcgtcttcagctgctcagttcggggctcacgagcagacgcatgccatg
tatgcatgtcccaaattaccatacaacaaggagacaagcccttctttctactttgccatt
tccaccggctccctcgctcagcagtacgcacatcctaatgccaccctgcatccacaccct
ccacatcctcagccttcggccactcccaccggacagcaacaaagccagcatggtggaagt
catcctgcacccagtcctgttcagcaccatcagcaccaggccgcccaggctcttcacctg
gccagtccacagcagcagtcggccatttatcacgcggggctggcaccaacaccaccttcc
atgacacctgcctctaatacacagtctccacagagcagtttcccagcagcaccacagaca
gtcttcaccatccatccttctcatgttcagccggcatacaccaccccaccccacatggcc
cacgtacctcaggctcatgtacagtcaggaatggttccttctcatccaactgcccatgcg
ccaatgatgcttatgacgacacagccacccggcggtccccaggccgccctcgctcaaagt
gcactacagcccattccagtctcgacaacagcgcatttcccctatatgacgcacccttca
gtacaagcccaccaccaacagcagttgtaa

KEGG   Rattus norvegicus (rat): 361649
Entry
361649            CDS       T01003                                 

Gene name
Atxn2l
Definition
(RefSeq) ataxin-2-like protein
  KO
K23625  ataxin 2/2L
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05014  Amyotrophic lateral sclerosis
rno05017  Spinocerebellar ataxia
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    361649 (Atxn2l)
   05017 Spinocerebellar ataxia
    361649 (Atxn2l)
   05022 Pathways of neurodegeneration - multiple diseases
    361649 (Atxn2l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    361649 (Atxn2l)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     361649 (Atxn2l)
SSDB
Motif
Pfam: SM-ATX LsmAD PAM2 LSM14
Other DBs
NCBI-GeneID: 361649
NCBI-ProteinID: NP_001123569
RGD: 1565868
Ensembl: ENSRNOG00000018686
UniProt: B3DMA1
Position
1
AA seq 1072 aa
MLKPQPPQQTSQPQQPPPTQQAVARRPPGGTSPPNGGLPGPLPATAAPPGPPTVVSPCLG
PAAAAGSGLRRGAESILAAPAPQQHQERPGAVAIGSVRGQTTGKGPPQSPVFEGVYNNSR
MLHFLTAVVGSTCDVKVKNGTTYEGIFKTLSSKFELAVDAVHRKASEPAGGPRREDIVDT
MVFKPSDVLLVHFRNVDFNYATKDKFTDSAIAMNSKVNGEHKEKVLQRWEGGDSNSDDYD
LESDMSNGWDPNEMFKFNEENYGVKTTYDSSLSSYTVPLEKDNSEEFRQRELRAAQLARE
IESSPQYRLRIAMENDDGRTEEEKHSAVQRQGSGRESPSLVSREGKYIPLPQRVREGPRG
GVRCSSSRGGRPGLSSLPPRGPHHLDNSSPGPGSEARGINGGPSRMSPKAQRPLRGGKTL
SSPNNRPSGEASVPPTSAVGRMYPPRSPKSAAPAPVSASCPEPPIGSAVASSASIPVTSS
VVDPGAGSISPASPKLSLAPTDVKELPTKEPSRSLEAQELARIAGKVPGLQNEQKRFQLE
ELRKFGAQFKLQPSSSSETGLDPFPSRILKEEAKGKEKEVDGLLTSDPMGSPVSSKAESI
LDKEDKVPLAAVAGSEGPEQLQPPCPSQTGSPPVGLIKGDDKEEGPVTEQVKKSTLNPNA
KEFNPTKPLLSVNKSTSTPTSPGPRTHSTPSIPVLTAGQSGLYSPQYISYIPQIHMGPAV
QAPQMYPYPVSNSVPGQQGKYRGAKGSLPPQRSDQHQPASAPPMMQAAAAAAGPPLVAAT
PYSSYIPYNPQQFPGQPAMMQPMAHYPSQPVFAPMLQSNPRMLTSGSHPQAIVSSSTPQY
PSAEQPTPQALYATVHQSYPHHATQLHGHQPQPATTPTGSQPQSQHAAPSPVQAGQAPHL
GSGQPQQNLYHPGALTGTPPSLPPGPSAQSPQSSFPQPAAVYAIHPHQQLPHGFTNMAHV
TQAHVQTGVTAAPPPHPGAPHPPQVMLLHPPQGHGGPPQGAVPPSGVPALSASTPSPYPY
IGHPQGEQPGQAPGFPGGADDRIREFSLAGGIWHGRAEGLQVGQDARVLGGD
NT seq 3219 nt   +upstreamnt  +downstreamnt
atgttgaagcctcagccgccacaacagacctcccagccccagcagccgccccccacgcaa
caggccgtggctcgccggcctcccggcgggactagccctcccaacggcggcctcccggga
ccgctgcccgctaccgcggctcccccggggcctcccacagtggtctctccgtgcctgggg
cctgcagccgctgccggcagcgggctccgccgcggagccgaaagcatcttggcggcgcca
gcgccgcagcagcatcaagaacggccaggggcagtggctatcggcagcgtcaggggacag
accaccggaaagggacccccacagtcaccagtgtttgaaggtgtctataacaattccagg
atgctgcatttcctgacagctgtagtgggttctacctgtgatgtaaaagtgaaaaatggc
accacttatgagggcattttcaagacgctgagctcaaagtttgaactggcagtagatgcg
gtacatcggaaagcctctgagccagcaggtgggcctcgtcgggaagacattgtggacacc
atggtgtttaaaccaagtgatgttctgcttgtccacttccgaaatgttgacttcaattat
gctactaaagacaagttcactgactcagccattgccatgaactctaaggtgaatggagaa
cacaaagagaaggtgcttcagcgttgggagggcggtgacagcaacagtgatgactacgat
ctggaatccgatatgtctaatggatgggatcctaatgagatgttcaaatttaatgaggag
aactatggagtgaagaccacctatgacagcagtctatcttcttacacggttcccttagaa
aaggacaactctgaagagtttcggcagcgggagcttcgcgcggcccagttggctcgggag
attgagtctagtccccagtaccgtctacggattgccatggaaaatgacgacgggcgaacc
gaggaggagaagcacagtgcagttcagcggcaggggtccgggcgggagagccccagcttg
gtgtccagggaagggaaatatatccctctgcctcaacgagttcgggaaggtccccgggga
ggagttcgatgcagcagttctcgaggagggcggcctggccttagctctttgccacctcgt
ggccctcaccatcttgacaacagcagtcctggtcctgggtctgaggcacgtggtatcaat
ggaggtccttcccgcatgtcccccaaggcacagcggcctctgagaggtggcaagacctta
tcttcacccaacaataggccttctggagaagcttctgttcctccaacatctgcagtgggc
cggatgtaccctccacggtctcccaagtctgctgcccctgccccagtctcagcttcctgt
cctgagcctcccattggttcagcagtagcatcctctgcctccatccctgtgacatcatca
gttgtggatcctggagcaggctctatttccccagcatctccaaaactctccctggcccct
acagatgtaaaagaactcccaaccaaggagcccagtaggagtttggaagcccaagagctg
gcccgcatagctgggaaagtccctggccttcagaatgaacaaaaacgctttcagttggaa
gaactgaggaaatttggggcccagtttaagcttcaacctagtagctcctctgagacgggc
ctggatccatttccttcccggatcttgaaagaagaggccaaaggaaaggagaaagaagtg
gatggtctattgacttcagatcctatgggatccccagtctcctccaaggcagaatccata
ttggataaggaagacaaagtgcccctggcagcagtagcggggtctgaggggccagaacag
ctccaaccaccttgccccagccaaactggcagtcctccagtgggcctcatcaagggagat
gacaaagaggagggcccggttactgaacaagtaaagaagtctactttgaaccccaatgcc
aaggagttcaatccaacaaagcctctgctgtctgtgaacaaatctaccagtactccaact
tcaccagggccccgtactcattcaacaccttccataccggtgctgacagcaggccagagt
gggctctacagtccccagtacatctcatatatacctcagatccacatgggaccagctgtg
caggcacctcagatgtatccatatcctgtatccaattcggtgcctgggcagcagggcaag
taccggggtgcaaaaggctcacttcccccccagcgctctgaccaacaccaaccagcctca
gcccctccaatgatgcaggctgctgctgctgctgctggcccacccttggtggctgccaca
ccttattcctcctacatcccttacaacccacagcagttcccaggccagcctgccatgatg
cagcccatggcacactacccttcacagccggtgttcgcccctatgcttcaaagtaatcca
cgaatgttgacatcgggaagccatccccaggccatcgtgtcatcctccactcctcagtac
ccttctgcagagcagcctaccccccaagccctttatgccactgttcaccagtcctatcca
caccatgccacgcagctccatggccaccagcctcagccggccaccactcctactgggagc
caaccacaatcccagcatgcggcccccagtcccgttcaggcggggcaggccccacacctg
ggcagtggacaaccacagcagaatctgtaccatccaggggccctaacaggcacgccacct
tctctaccaccgggaccttctgcccagtcccctcaaagcagcttcccccagccagctgct
gtgtatgccatccatccccaccagcagctgccccacggcttcaccaacatggcccatgtt
acccaggcccatgtccaaactggagtcacagcagccccgcccccacaccctggggctccc
cacccgccccaggtgatgctgctgcaccccccccagggccatgggggccccccccaaggc
gcggtgcccccgagtggggtgcctgcactctcagcttccacaccctcaccctacccctac
atcggacacccccaaggtgagcagcctggccaggcgcctggatttccaggaggagccgat
gacaggattcgtgagttctcgttagctgggggaatttggcatggaagagctgaggggctg
caggtggggcaggatgcacgggttctgggtggggattga

KEGG   Rattus norvegicus (rat): 60331
Entry
60331             CDS       T01003                                 

Gene name
Atxn3
Definition
(RefSeq) ataxin-3
  KO
K11863  Ataxin-3 [EC:3.4.22.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
rno05017  Spinocerebellar ataxia
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    60331 (Atxn3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    60331 (Atxn3)
   05022 Pathways of neurodegeneration - multiple diseases
    60331 (Atxn3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    60331 (Atxn3)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    60331 (Atxn3)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     60331 (Atxn3)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C86
   60331 (Atxn3)
Ubiquitin system [BR:rno04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   MJD
    60331 (Atxn3)
SSDB
Motif
Pfam: Josephin SUIM_assoc UIM
Other DBs
NCBI-GeneID: 60331
NCBI-ProteinID: NP_067734
RGD: 621567
Ensembl: ENSRNOG00000005470
UniProt: O35815
Position
6
AA seq 355 aa
MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERLRMAEGGVTSEDYRT
FLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHW
FTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQM
IKVQQMHRPKLIGEELAHLKEQSALKADLERVLEAADGPGMFDDDEDDLQRALAMSRQEI
DMEDEEADLRRAIQLSMQGSSRGMCEDSPQTSSTDLSSEELRKRREAYFEKQQHQQQEAD
RPGYLSYPCERPTTSSGGLRSNQAGNAMSEEDVLRATVTVSLETAKDSLKAERKK
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggagtccatcttccacgagaaacaagaaggctccctttgcgctcagcattgcttgaat
aacctcttacaaggagagtattttagccccgtggagctgtcctcaattgcacaccagctg
gatgaagaggagaggctgcggatggcggaaggaggggtcaccagcgaagactaccgcaca
tttttacagcagccttctggaaatatggacgacagcggctttttctctattcaagttata
agcaatgccttgaaagtttggggtttagaactaatcctattcaacagtccagagtaccag
aggctcagaatcgatcctataaatgaaagatcctttatatgcaattataaagaacactgg
tttacagttagaaaattaggaaaacagtggtttaacttgaattctttgttgactggtcca
gagctaatatcagatacatacctcgcactgttcttggctcagttacagcaagaaggttat
tctatatttgttgttaagggtgatctgccagattgtgaagctgaccaacttttacagatg
atcaaggtccaacagatgcatcgaccaaaacttattggagaagaactcgcacatctgaaa
gagcagagcgccctcaaagcagatctggagcgagtcttagaggcggctgacgggccggga
atgtttgatgatgatgaggacgatttacagagggctctggccatgagtcgccaggaaatc
gacatggaggacgaagaagccgatctccgcagggccattcagctcagtatgcaaggtagt
tccagaggtatgtgtgaagatagtccgcagacatcaagcacagatctttcttcagaagag
ctgcggaagaggagagaagcctactttgaaaagcaacagcatcagcaacaggaagcagac
cgacctggatacctttcatacccatgtgaaagacccaccacaagttcaggaggactccgg
agcaaccaagcaggcaatgctatgagtgaagaggacgtgcttcgggcaactgtgactgtg
tctttagaaactgctaaagacagtttgaaagcagaaagaaaaaaatag

DBGET integrated database retrieval system