KEGG   Rattus norvegicus (rat): 290257
Entry
290257            CDS       T01003                                 

Symbol
Ctsg
Name
(RefSeq) cathepsin G precursor
  KO
K01319  cathepsin G [EC:3.4.21.20]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04142  Lysosome
rno04613  Neutrophil extracellular trap formation
rno04614  Renin-angiotensin system
rno05146  Amoebiasis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    290257 (Ctsg)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    290257 (Ctsg)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    290257 (Ctsg)
  09152 Endocrine system
   04614 Renin-angiotensin system
    290257 (Ctsg)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    290257 (Ctsg)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    290257 (Ctsg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    290257 (Ctsg)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    290257 (Ctsg)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.20  cathepsin G
     290257 (Ctsg)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S1: chymotrypsin family
   290257 (Ctsg)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Others
   290257 (Ctsg)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986 zf-RING_13
Other DBs
NCBI-GeneID: 290257
NCBI-ProteinID: NP_001099511
RGD: 1307681
Ensembl: ENSRNOG00000020647
UniProt: G3V9Q7
Position
15
AA seq 250 aa
MQPLLFLLIFVLFQEDEAGKIIGGREARPNSHPYMAFLLIQSPEGLSACGGFLVREDFVL
TAGHCFGSSINVTLGAHNIRRQEGTQQHITVLRAIRHPDYNPPPVIQNDIMLLQLRSRAR
RSRAVKPVALPQATKRVQPGALCTVAGWGLVSQRRGTNVLQEVKLRVQTDQTCANRFQFY
NSQTQICVGNPRERKSAFKGDSGGPLVCNNVAQGIVSYGSSSGNPPAVFTRIQSFMPWIK
RTMRRLSSRY
NT seq 753 nt   +upstreamnt  +downstreamnt
atgcagccactcctgtttctgttgatctttgttctattccaagaagatgaggcaggaaag
atcattggaggccgagaagccaggccaaattcccacccctacatggcatttcttctgatc
cagagtccagaagggctgagtgcttgtggagggtttctggtgcgagaagactttgtcctc
acagcaggtcactgctttggaagctccataaatgttaccctaggggcccacaacattcga
aggcaagaagggacccagcaacacatcactgttctcagagccatccgccatcctgattac
aatcccccgccagtcatccagaatgacatcatgctactgcagctgaggagtagagcccgg
aggagtcgagcggtgaagcccgtggctctgcctcaagccaccaagagagtacaaccaggg
gctttgtgcacagtggctggctggggcctggtgagccagcgcagggggacaaatgtactc
caggaggtgaagctaagagtgcagacggaccaaacgtgcgccaatcgtttccaattctac
aacagccagactcagatctgtgtgggaaacccgagagaaaggaagtctgccttcaagggt
gattctggtggtcctctggtatgtaataatgtggcccagggcatcgtctcctatggaagc
agcagtggtaaccctccagctgtgttcaccagaatccagagcttcatgccctggatcaaa
agaacaatgagacgtctttcctcaaggtattag

DBGET integrated database retrieval system